KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111645313
Entry
111645313         CDS       T06058                                 

Definition
(RefSeq) RAC-gamma serine/threonine-protein kinase
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal04010  MAPK signaling pathway
slal04012  ErbB signaling pathway
slal04068  FoxO signaling pathway
slal04140  Autophagy - animal
slal04150  mTOR signaling pathway
slal04210  Apoptosis
slal04218  Cellular senescence
slal04261  Adrenergic signaling in cardiomyocytes
slal04370  VEGF signaling pathway
slal04371  Apelin signaling pathway
slal04510  Focal adhesion
slal04620  Toll-like receptor signaling pathway
slal04625  C-type lectin receptor signaling pathway
slal04910  Insulin signaling pathway
slal04914  Progesterone-mediated oocyte maturation
slal04920  Adipocytokine signaling pathway
slal05132  Salmonella infection
slal05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:slal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111645313
   04012 ErbB signaling pathway
    111645313
   04370 VEGF signaling pathway
    111645313
   04371 Apelin signaling pathway
    111645313
   04068 FoxO signaling pathway
    111645313
   04150 mTOR signaling pathway
    111645313
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    111645313
  09143 Cell growth and death
   04210 Apoptosis
    111645313
   04218 Cellular senescence
    111645313
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111645313
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111645313
   04625 C-type lectin receptor signaling pathway
    111645313
  09152 Endocrine system
   04910 Insulin signaling pathway
    111645313
   04920 Adipocytokine signaling pathway
    111645313
   04914 Progesterone-mediated oocyte maturation
    111645313
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    111645313
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111645313
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    111645313
Enzymes [BR:slal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     111645313
Protein kinases [BR:slal01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   111645313
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Pkinase_C Kinase-like APH
Other DBs
NCBI-GeneID: 111645313
NCBI-ProteinID: XP_023250223
LinkDB
Position
Unknown
AA seq 479 aa
MSDVTIVREGWLQKRGEYIKNWRPRYFLLKTDGSFIGYKEKPQDADLPYPLNNFSVAKCQ
LMKTERPKPNTFIIRCLQWTTVIERTFHVDSPDERDEWTEAIQMVADKLQRQEEERIQCS
PTSNIDNMVEEEMDISTTHHKRKTMSDFDYLKLLGKGTFGKVILVREKASGKYYAMKILK
KEVIIAKDEVAHTLTESRVLKNTRHPFLTSLKYSFQTKDRLCFVMEYVNGGELFFHLSRE
RVFSEERTRFYGAEIVSALDYLHSAKIVYRDLKLENLMLDKDGHIKITDFGLCKEGITDA
ATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVTYEMMCGRLPFYNQDHEKLFELILM
EDIKFPRTLSADAKSLLSGLLIKDPNKRLGGGPDDAKEIMRHSFFSGVDWQDVYDKKLVP
PFKPQVTSETDTRYFDEEFTAQTITITPPEKFDEDGMDCLDNERRPHFPQFSYSASGRE
NT seq 1440 nt   +upstreamnt  +downstreamnt
atgagcgatgtcaccatcgttagagagggatggctccagaaacggggtgaatacataaag
aactggcgaccgcgttacttcctgttgaagacagacggctctttcatcggctacaaagag
aaacctcaggatgcagacctgccctaccccctaaataacttttctgtagcaaaatgtcag
ctgatgaagacggagaggccgaagccaaacaccttcatcatacgctgcctccaatggacc
acagtcatcgagagaaccttccacgtggactcgcctgatgagagagatgagtggacagag
gccatccagatggtggctgacaagctgcagagacaagaggaggagaggatccagtgcagc
cctacttccaatattgacaacatggttgaagaggagatggacatctccaccacacaccac
aaacgcaagacaatgagtgacttcgactacctgaagctgctgggaaagggaacctttggg
aaagtgattcttgtccgagaaaaggccagcgggaaatattatgccatgaaaatccttaaa
aaagaagtcatcattgccaaggatgaagtggcacacacactcacagagagcagagtactg
aaaaacaccagacacccctttctcacttcattgaagtattcattccagactaaagaccgc
ctctgtttcgtcatggagtatgtgaatggaggagagctgtttttccatttgtccagagag
cgggtgttctcagaagagcgcacgcgcttctatggcgccgagatcgtctccgctctcgac
tacctgcattcagccaagattgtgtaccgggacctcaagttggaaaacctgatgctggat
aaagatggccatattaagatcactgattttggtctctgcaaggagggcatcacagatgct
gctaccatgaagaccttctgtggcactccagagtaccttgcaccagaggtcttggaggac
aacgactacggtcgggcggtggactggtggggtttgggtgtggtgacgtacgagatgatg
tgtggccgactgccgttctacaaccaggaccatgagaagctgtttgagctcatcctcatg
gaggacatcaagttcccgcgcactctgtcagccgacgccaagtccctgctgtccggcctg
ctcatcaaagatcccaacaaacggcttggtggaggaccagatgacgctaaagaaataatg
agacacagtttcttctctggcgttgactggcaggacgtctatgataaaaagctggtccct
ccgttcaagcctcaggtgacgtcagagacggacaccagatactttgacgaggagttcaca
gcccagaccattacaatcactccaccagaaaaatttgacgaggacgggatggactgtcta
gacaacgagagaagaccgcacttcccacagttctcctactcagccagcgggcgggaatga

KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111653974
Entry
111653974         CDS       T06058                                 

Definition
(RefSeq) RAC-beta serine/threonine-protein kinase-like
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal04010  MAPK signaling pathway
slal04012  ErbB signaling pathway
slal04068  FoxO signaling pathway
slal04140  Autophagy - animal
slal04150  mTOR signaling pathway
slal04210  Apoptosis
slal04218  Cellular senescence
slal04261  Adrenergic signaling in cardiomyocytes
slal04370  VEGF signaling pathway
slal04371  Apelin signaling pathway
slal04510  Focal adhesion
slal04620  Toll-like receptor signaling pathway
slal04625  C-type lectin receptor signaling pathway
slal04910  Insulin signaling pathway
slal04914  Progesterone-mediated oocyte maturation
slal04920  Adipocytokine signaling pathway
slal05132  Salmonella infection
slal05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:slal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111653974
   04012 ErbB signaling pathway
    111653974
   04370 VEGF signaling pathway
    111653974
   04371 Apelin signaling pathway
    111653974
   04068 FoxO signaling pathway
    111653974
   04150 mTOR signaling pathway
    111653974
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    111653974
  09143 Cell growth and death
   04210 Apoptosis
    111653974
   04218 Cellular senescence
    111653974
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111653974
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111653974
   04625 C-type lectin receptor signaling pathway
    111653974
  09152 Endocrine system
   04910 Insulin signaling pathway
    111653974
   04920 Adipocytokine signaling pathway
    111653974
   04914 Progesterone-mediated oocyte maturation
    111653974
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    111653974
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111653974
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    111653974
Enzymes [BR:slal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     111653974
Protein kinases [BR:slal01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   111653974
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Pkinase_C Kinase-like PH_11
Other DBs
NCBI-GeneID: 111653974
NCBI-ProteinID: XP_023260543
LinkDB
Position
Unknown
AA seq 480 aa
MNEVNIVREGWLHKRGEYIKTWRPRYFILKSDGSFIGYKEKPDLNDQTSPPLNNFSVAEC
QLMKTERPRPNTFVIRCLQWTTVIERTFHVDSNEEREEWMRAIQSVANSLKMREQEEEEP
MDMFGSPSESSLEEMEVAMSKSNTKVTMSDFEYLKLLGKGTFGKVILVKEKSTGVHYAMK
ILRKEVIIAKDEVAHTVTESRVLQNTRHPFLTTLKYAFQTNDRLCFVMEYANGGELFFHL
SRERVFTEDRARFYGAEIVSALEYLHSRDVVYRDLKLENLMLDKDGHIKITDFGLCKEGI
TPDATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFEL
ILMEEIRFPRNLSPEAKSLLAGLLKKDPKQRLGGGPNDAKDVMSHKFFTIINWQDVVQKK
LTPLFRPQVTSETDTRYFDEEFTAQTITLTPPDKYNSLDCEDPGQQAHFPQFSYSASIRE
NT seq 1443 nt   +upstreamnt  +downstreamnt
atgaatgaagttaatatagtcagagagggttggctccacaaaagaggtgaatatatcaaa
acatggaggcccaggtatttcatcctgaagagtgacggttccttcatcggctacaaggag
aagccagatctaaacgaccagacttcaccacccctcaacaacttctcagtagcagaatgc
cagttaatgaagacagaaagaccccggcccaacacatttgtcatccgttgcctacagtgg
actactgtcattgaacgtacctttcatgtggacagcaatgaggagagagaggagtggatg
cgggcaatccagtctgtggcaaatagtctgaagatgagagaacaggaggaagaagagcca
atggatatgtttggctcacctagtgaaagcagcctcgaggagatggaggtggcgatgtcc
aagagcaacaccaaagtgacaatgagtgactttgagtacttgaagctgcttggcaagggg
acatttgggaaggtgattctggtcaaggagaagtccaccggagtacattatgccatgaaa
atactgcgcaaagaggtcataatagccaaggatgaggtggcccacacagttacagagagc
agagtgttacaaaacacacgacaccccttcctcacgacactgaaatatgctttccaaacc
aatgatcgactctgttttgtaatggaatatgccaacggaggcgagctcttcttccacctg
tcacgggaacgagtcttcacagaagaccgggcacgcttctacggtgccgagattgtgtca
gctctcgaatacctgcattcacgtgatgtcgtttacagggatctgaagctggagaatctt
atgctggacaaagatggccacatcaaaatcactgattttggcctttgtaaggagggcatt
actccagatgctaccatgaaaaccttctgtggaactcctgaatatctagcacctgaggtc
ctagaagataatgactacggccgggcagtggactggtggggtctgggtgtagtcatgtat
gagatgatgtgtgggcgtctgcctttctacaaccaggaccatgaacgtttgtttgagctc
atcctcatggaggagatccgcttcccccggaacctgtcgcccgaggccaagtccctgctg
gctggcctgctcaagaaggatcccaaacagaggttaggcggagggcccaacgatgccaaa
gatgtaatgagtcacaaatttttcaccatcatcaactggcaagatgtggtacagaagaag
ctcacccccctcttcagaccacaagtgacatcagagacggacactcggtactttgatgaa
gagttcacagcgcagaccatcactctcactccaccagacaagtataatagtctggactgt
gaggatcctggccagcaagcacatttcccccagttctcctattctgccagcataagagag
tga

KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111659458
Entry
111659458         CDS       T06058                                 

Definition
(RefSeq) RAC-gamma serine/threonine-protein kinase-like
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal04010  MAPK signaling pathway
slal04012  ErbB signaling pathway
slal04068  FoxO signaling pathway
slal04140  Autophagy - animal
slal04150  mTOR signaling pathway
slal04210  Apoptosis
slal04218  Cellular senescence
slal04261  Adrenergic signaling in cardiomyocytes
slal04370  VEGF signaling pathway
slal04371  Apelin signaling pathway
slal04510  Focal adhesion
slal04620  Toll-like receptor signaling pathway
slal04625  C-type lectin receptor signaling pathway
slal04910  Insulin signaling pathway
slal04914  Progesterone-mediated oocyte maturation
slal04920  Adipocytokine signaling pathway
slal05132  Salmonella infection
slal05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:slal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111659458
   04012 ErbB signaling pathway
    111659458
   04370 VEGF signaling pathway
    111659458
   04371 Apelin signaling pathway
    111659458
   04068 FoxO signaling pathway
    111659458
   04150 mTOR signaling pathway
    111659458
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    111659458
  09143 Cell growth and death
   04210 Apoptosis
    111659458
   04218 Cellular senescence
    111659458
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111659458
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111659458
   04625 C-type lectin receptor signaling pathway
    111659458
  09152 Endocrine system
   04910 Insulin signaling pathway
    111659458
   04920 Adipocytokine signaling pathway
    111659458
   04914 Progesterone-mediated oocyte maturation
    111659458
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    111659458
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111659458
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    111659458
Enzymes [BR:slal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     111659458
Protein kinases [BR:slal01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   111659458
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Pkinase_C Kinase-like
Other DBs
NCBI-GeneID: 111659458
NCBI-ProteinID: XP_023268195
LinkDB
Position
Unknown
AA seq 479 aa
MSDQNVVKEGWVQKRGEYIKNWRPRYFLLKTDGSFIGYKDKPQDSDLAYPLNNFSVAKCQ
LMKTERPKPNTFIIRCLQWTTVIERTFHVDTPDERDEWAEAIQMVAESLAKQEEEGILCS
PTSQIENVNEEEMDTSISHYKRKTMNDFDYLKLLGKGTFGKVILVREKASGTYYAMKILK
KEVIIAKDEVAHTLTESRVLKNTRHPFLTSLKYSFQTKDRLCFVMEYVNGGELFFHLSRE
RVFSEDRTRFYGAEIVSALDYLHSAKIVYRDLKLENLMLDKDGHIKITDFGLCKEGITDT
ATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVTYEMMCGRLPFYNQDHEKLFELILM
EEIKFPRTLSADAKSLLSGLLIKDPNKRLGGGPDDAKEIMRHSFFGTIDWQDVYDKKLVP
PFQPQVTSETDTRYFDEEFTAQTITITPPEKYDEDGMDAADNERRPHFPQFSYSASGRE
NT seq 1440 nt   +upstreamnt  +downstreamnt
atgagcgaccagaacgtcgtcaaggaaggctgggtccagaaaagaggtgagtacatcaag
aactggcgaccgcgctacttcctgctgaagacagacggctccttcatcggctacaaggac
aaaccgcaggactctgacctggcctacccgctcaacaacttctctgtagcaaaatgtcag
ctgatgaagacggagcggcccaagccgaacaccttcatcatccgctgcctgcagtggacc
accgtcatcgagaggacttttcatgtcgacacgcccgacgagagggacgagtgggcggag
gccatccagatggtcgccgagtctctggccaagcaggaggaggagggcatcctgtgcagc
cccacctcccagatcgagaacgtcaacgaggaggagatggacacctccatcagccactac
aaacgaaagacaatgaatgactttgactatctgaagcttctgggcaaaggcacttttggg
aaagtcattctggtgagggagaaggcgagcggcacctactacgccatgaagatcttgaag
aaggaagtcattatagccaaggatgaagttgctcacacactcacagaaagtagggtatta
aaaaacactcggcatccattcctaacttctctgaagtactcgttccagactaaggaccgg
ctgtgctttgtaatggagtacgtcaacggaggagagctgtttttccacttgtcaagagaa
agagttttttcagaggaccgcacccgtttctacggtgcagagatcgtctctgctctcgac
tacctacattctgccaagatcgtctaccgtgacctgaagctggagaacctcatgttggac
aaagacggccacatcaagatcaccgacttcggcctctgcaaagaaggcatcaccgacact
gccacgatgaagacgttctgtggaacaccagagtacctggctcctgaggtgttggaggac
aacgactacgggcgggcggtggactggtggggtttgggcgtggtgacgtacgagatgatg
tgcggccgcctgccgttctacaaccaggaccacgagaagctgtttgagctcatcctcatg
gaggagatcaagttcccgcgaaccctgtcggccgacgccaagtcgctgctgtcgggactc
ctcatcaaggaccccaacaaacgactgggcggcggaccggatgacgctaaggagatcatg
cgacacagtttctttggcacaatcgactggcaggacgtctacgacaagaagctggtcccg
cccttccagccccaggtcacctcggagacggacacacgctacttcgacgaggagttcaca
gcacagaccatcaccatcactccgccggaaaaatacgatgaggacgggatggacgcggcg
gacaacgagcgaaggcctcatttcccacagttctcctactcagccagcgggcgggagtga

KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111665447
Entry
111665447         CDS       T06058                                 

Definition
(RefSeq) RAC-beta serine/threonine-protein kinase
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal04010  MAPK signaling pathway
slal04012  ErbB signaling pathway
slal04068  FoxO signaling pathway
slal04140  Autophagy - animal
slal04150  mTOR signaling pathway
slal04210  Apoptosis
slal04218  Cellular senescence
slal04261  Adrenergic signaling in cardiomyocytes
slal04370  VEGF signaling pathway
slal04371  Apelin signaling pathway
slal04510  Focal adhesion
slal04620  Toll-like receptor signaling pathway
slal04625  C-type lectin receptor signaling pathway
slal04910  Insulin signaling pathway
slal04914  Progesterone-mediated oocyte maturation
slal04920  Adipocytokine signaling pathway
slal05132  Salmonella infection
slal05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:slal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111665447
   04012 ErbB signaling pathway
    111665447
   04370 VEGF signaling pathway
    111665447
   04371 Apelin signaling pathway
    111665447
   04068 FoxO signaling pathway
    111665447
   04150 mTOR signaling pathway
    111665447
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    111665447
  09143 Cell growth and death
   04210 Apoptosis
    111665447
   04218 Cellular senescence
    111665447
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111665447
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111665447
   04625 C-type lectin receptor signaling pathway
    111665447
  09152 Endocrine system
   04910 Insulin signaling pathway
    111665447
   04920 Adipocytokine signaling pathway
    111665447
   04914 Progesterone-mediated oocyte maturation
    111665447
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    111665447
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111665447
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    111665447
Enzymes [BR:slal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     111665447
Protein kinases [BR:slal01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   111665447
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Kinase-like Pkinase_C PH_11
Other DBs
NCBI-GeneID: 111665447
NCBI-ProteinID: XP_023276223
LinkDB
Position
Unknown
AA seq 482 aa
MNEVSVVREGWLHKRGEYIKTWRPRYFILKSDGSFIGYKEKPEVSSDHSLPPLNNFSVAE
CQLMKTERPRPNTFVIRCLQWTSVIERTFHVDSNEEREEWMRSIQAVANSLKSQQQDEEP
MEIKFGSPSDSSGTEEMEIAVSKSHTKVTMSDFDYLKLLGKGTFGKVILVKEKATGMYYA
MKILRKEVIIAKDEVAHTVTESRVLQNTRHPFLTTLKYAFQTHDRLCFVMEYANGGELFF
HLSRDRVFTEDRARFYGAEIVSALEYLHSRNVVYRDLKLENLMLDKDGHIKITDFGLCKE
GITDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLF
ELILMEEIRFPKNLAPEAKALLAGLLKKDPKQRLGGGPDDAKEVMSHKFFTSINWQDVTE
KKLIPPFKPQVTSETDTRYFDDEFTAQTITITPPDKYDSLDAEDSDQRTHFPQFSYSASI
RE
NT seq 1449 nt   +upstreamnt  +downstreamnt
atgaatgaagtcagtgttgtgagagagggatggctccacaagagaggtgaatacatcaaa
acatggcggcctcgttacttcatcttaaagagcgatggctcctttattggctacaaagag
aagcctgaggtgtccagtgaccacagcctcccgccgctcaacaacttctctgtcgcagaa
tgccagctgatgaagacagagcgccccaggcccaacacgtttgtcattcgttgtctgcag
tggacctcggttattgagcgcacctttcacgtggacagcaacgaggagagggaggaatgg
atgcgatcgatccaggcagtggcaaatagcctgaagagtcagcagcaggatgaggagccc
atggagatcaaatttggctctccaagtgacagcagcggcacagaggagatggagattgct
gtgtccaaatcccacacaaaagtgaccatgagtgactttgactacctgaagctgctcggc
aaagggacatttggtaaagttatcctggtgaaggaaaaggccacggggatgtactacgcc
atgaaaatccttcgcaaagaagtcatcattgctaaagatgaggtggcacacacagttacg
gaaagcagagttctccaaaatacacggcacccattcctaacgacactaaaatatgcattt
caaacacatgaccggctatgctttgtgatggagtatgcaaatggaggagaactcttcttt
cacttatcacgggatagagtattcacagaagacagagcacgattctatggtgcagaaata
gtgtcagcactggagtacctacactcacgcaatgtagtttacagggatttgaagctggag
aacctcatgttagacaaggacggccacataaagataacagactttgggttatgtaaagag
gggatcacagatggcgccactatgaaaaccttctgtggaaccccggaatacctggcacca
gaggtgctggaggacaatgactacgggcgagcggtagactggtggggactgggtgttgtc
atgtatgagatgatgtgtggtcggttgcccttctacaaccaggaccatgagcgtctattt
gagctcatcctcatggaggaaatacgcttccccaagaatctggctcctgaagccaaggcc
ctgctggctggtctcctcaaaaaggatcctaaacaaaggctcggaggcggaccggacgat
gccaaagaagtgatgagccacaagttcttcacctccatcaactggcaggatgtcactgaa
aagaagcttatcccacccttcaagccccaggtaacatcagagacggacacgcgttatttc
gatgatgagttcacagcacaaaccattacgataactcctccagataagtatgacagttta
gatgcagaggattcagatcagcgtacacacttccctcagttctcctactctgccagcata
cgggaatga

KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111673263
Entry
111673263         CDS       T06058                                 

Gene name
akt1
Definition
(RefSeq) RAC-alpha serine/threonine-protein kinase isoform X1
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal04010  MAPK signaling pathway
slal04012  ErbB signaling pathway
slal04068  FoxO signaling pathway
slal04140  Autophagy - animal
slal04150  mTOR signaling pathway
slal04210  Apoptosis
slal04218  Cellular senescence
slal04261  Adrenergic signaling in cardiomyocytes
slal04370  VEGF signaling pathway
slal04371  Apelin signaling pathway
slal04510  Focal adhesion
slal04620  Toll-like receptor signaling pathway
slal04625  C-type lectin receptor signaling pathway
slal04910  Insulin signaling pathway
slal04914  Progesterone-mediated oocyte maturation
slal04920  Adipocytokine signaling pathway
slal05132  Salmonella infection
slal05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:slal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111673263 (akt1)
   04012 ErbB signaling pathway
    111673263 (akt1)
   04370 VEGF signaling pathway
    111673263 (akt1)
   04371 Apelin signaling pathway
    111673263 (akt1)
   04068 FoxO signaling pathway
    111673263 (akt1)
   04150 mTOR signaling pathway
    111673263 (akt1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    111673263 (akt1)
  09143 Cell growth and death
   04210 Apoptosis
    111673263 (akt1)
   04218 Cellular senescence
    111673263 (akt1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111673263 (akt1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111673263 (akt1)
   04625 C-type lectin receptor signaling pathway
    111673263 (akt1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    111673263 (akt1)
   04920 Adipocytokine signaling pathway
    111673263 (akt1)
   04914 Progesterone-mediated oocyte maturation
    111673263 (akt1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    111673263 (akt1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111673263 (akt1)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    111673263 (akt1)
Enzymes [BR:slal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     111673263 (akt1)
Protein kinases [BR:slal01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   111673263 (akt1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Kinase-like Pkinase_C PH_11 Pkinase_fungal Seadorna_VP7
Other DBs
NCBI-GeneID: 111673263
NCBI-ProteinID: XP_023286743
LinkDB
Position
Unknown
AA seq 473 aa
MTNVVIVKEGWLHKRGEYIKTWRPRYFLLKSDGTFIGYKERPQDVDQLETPLNNFSVAQC
QLMKTERPKPNTFIIRCLQWTTVIERTFHVETPEEREEWTKAIQTVAEGLQKQEEEMMDS
SPDPMDMEVYLTKPRHKVTMHDFEYLKLLGKGTFGKVILVKEKATGRYYAMKILKKEVIV
AKDEVAHTLTENRVLQNSKHPFLTGLKYSFQTHDRLCFVMEYANGGELFFHLSRDRVFSE
ERARFYGAEIVSALDYLHAERNVVYRDLKLENLMLDKDGHIKITDFGLCKEGIKDGATMK
TFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILMEDIR
FPRTLGPEARSLLSGLLKKDPMQRLGGGPDDAKEIMQHKFFAGIEWQDVYEKKLVPPFKP
QVTSETDTRYFDEEFTAQTITITPPGQDDSMESFDSERRPHFPQFSYSASGTA
NT seq 1422 nt   +upstreamnt  +downstreamnt
atgaccaatgtggtgatcgtcaaggagggatggctgcataaaagaggagaatacatcaag
acctggaggccgaggtattttctcctgaagagtgatggtacattcattggctacaaagag
cgaccgcaagatgttgaccagctggaaacccccttaaataacttctctgtagcacaatgc
cagctgatgaagacggaacggcccaagcccaacacatttatcatccgctgcctgcagtgg
accactgtcatcgagcgcaccttccacgtggagacccctgaggagagggaagaatggact
aaagccatccagacagtggctgaaggccttcagaaacaagaggaggagatgatggactcc
tctccggaccccatggacatggaggtctaccttaccaaacccagacacaaagtgactatg
cacgactttgaatacctcaaactcctgggaaaaggcacttttggcaaagttatcctggta
aaggagaaggccacaggacgctactacgccatgaagatcctgaagaaggaggtgatcgta
gcaaaagatgaagtggcgcacacactcacagagaacagagtactccagaattcaaagcat
ccgttcttgacaggactgaaatactccttccagacgcatgaccgcctgtgcttcgtcatg
gagtatgccaacggtggtgagcttttcttccacctgtcaagggaccgggtattctcagag
gagcgggcacggttctacggtgcagagatagtgtcagcgctggactaccttcatgctgaa
agaaacgtggtctatcgagatctaaagctggaaaacctcatgctggacaaagatggacac
ataaagatcacagattttggcctgtgtaaggaggggatcaaagacggggccaccatgaaa
accttctgtgggacgccagagtacctcgcacctgaggtgctagaggacaacgactatggc
cgcgctgtggattggtggggtctgggagtggtgatgtacgagatgatgtgcggccgactg
cctttctacaaccaggaccacgagaagctgtttgagctcatcctcatggaagacatccgc
ttccctcggacacttggtcccgaggcacgctcgctgctctctggccttctcaagaaagac
ccaatgcagaggttaggcggagggcctgacgacgccaaggaaatcatgcagcacaagttc
ttcgcaggaattgaatggcaagatgtttatgagaagaagctggtcccgccgtttaagccc
caagttacctcggagacagacacacgatattttgacgaggagttcacagcacagaccatc
actattacaccacccggacaagatgacagtatggagtccttcgacagcgagcggagaccc
cacttcccccagttctcctactctgccagtgggacggcctga

DBGET integrated database retrieval system