KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111645375
Entry
111645375         CDS       T06058                                 

Gene name
lepr
Definition
(RefSeq) leptin receptor isoform X1
  KO
K05062  leptin receptor
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal04060  Cytokine-cytokine receptor interaction
slal04080  Neuroactive ligand-receptor interaction
slal04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:slal00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    111645375 (lepr)
   04060 Cytokine-cytokine receptor interaction
    111645375 (lepr)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    111645375 (lepr)
Cytokine receptors [BR:slal04050]
 Interleukin receptor families
  Prolactin receptor family
   111645375 (lepr)
CD molecules [BR:slal04090]
 Proteins
  111645375 (lepr)
SSDB
Motif
Pfam: ObR_Ig fn3 Lep_receptor_Ig Glycophorin_A
Other DBs
NCBI-GeneID: 111645375
NCBI-ProteinID: XP_023250346
LinkDB
Position
Unknown
AA seq 1180 aa
MRFTPGKAQQGHAHTMTTTMVRSVMLTVLMHIFLVSYGVQCLEPEEGTSLQAGALDLPWQ
DELCCDSPSAHLNVEGGGTHVPRTNRSGSNLPQYPRCSFRSLKTKSNSHEPSAGTCLDIL
CRIENWEKLTCDLQSHGDPSTTLDAGLMAVSLQRLLSQQEDSQVNYGNPASGDPVVCEAK
DSFMCSVALDTTTSFVTVVTVSISNAVALPVLLRVPARPVKPGPPVNLSHTQTIEAELIL
HWDDPPDFTDTGLLRYEVRYSFNTTNPAWQVVSAPTEPRLSLDLKPRLNYTIQVRCSGLE
EPPLWSEWSESHHIYLDTVSYIPEKVVARPGENVTVYCVFNDHSINASTAMWMLNFQQPL
HRSQYHPINQWVSQITVRPSETRMYDLLQCTQEWTIPYSQIYVEGASIDINCETNGDIDA
MDCSWKNTQWTKPKFRSRWADLSCDVMEERERAGEKVGEMGPACLPVRSREKSCTIQPLR
MNCYKLWLEVSSRLGPIRSKPVYLSPIDHVKPHTPTNVKAVSRSSGVLTVTWEPPSLPVQ
GLQCQFRYHSPSMVRAQPEWKVQSPVRVPSAEVVVPDMCRVYAVQVRCMHINISYWSDWS
DLAYSTPQNSRAPERGPDFWRVLQDDSYRNQTNVTLLFESLPVSGRSYCVDGFIVQHQFS
SGTVTREWIEPVSSYSFEWNQELHAVTVEAYNSLGSSTNNINMTLERQHKRRCVRSFHVL
VINSTCVSLSWSLLDNSSVVPLFMVVQWSPQRQQESDHHKVHSGETWARLPYTDRPVYLR
GDFFGSEEYGFYLYPVFADGEGEPMHAMAARGYPAAYMMLMIISFLSVVLFVTLVLSQNQ
MKRFVWKDVPNPNKCSWAKGLDFKKTDTFDHLFQPPDGLPAWPLLLPTENISKVVIMDKA
DLSALTTALVQTPLVSLTPDPVTDLAISVPPGFDSEVDQTHFIESEVLMDGAPPLALNLD
ALTSSHPGIDDLQPVDPPGDQPPSSTDSSAQSSVTYATVLLSGAKQKQQSIHLHYKDGSG
SSSSDEGNFSANNSDISGSFPGGLWELDSCRGGEMDDPRHSCSYNSVEELSETSEQEDEG
EVREEKDLFYLGMDYPAEDEESEEEEEQQTEEETKIGLLKKVVLNREDCPVETHHLLGPE
ESSERTERRSASTRGFSPLYLPQFRTAPCTRQLQDSKPQL
NT seq 3543 nt   +upstreamnt  +downstreamnt
atgagattcaccccaggcaaagcccagcaaggccatgctcacactatgaccactacaatg
gttcggtctgtgatgttgacagtcctgatgcatattttcctggtgtcctatggtgttcag
tgtttggagcctgaggagggaacctctctccaggcaggtgccctggatctcccatggcag
gatgagctgtgctgtgactcaccttcagcccacctcaatgtggagggaggcggcacgcat
gtacccaggacaaaccgctctggatcaaacctcccacagtatccccgctgcagcttcagg
agcttgaaaaccaaatcaaattctcatgagccctctgccggcacctgtttggacatactg
tgcagaattgaaaactgggagaaattaacttgtgatctccagtctcacggcgacccgtca
accactctggatgccggcctgatggcggtcagcttacagcgtctgttgtcccagcaagag
gattcacaggtgaactatgggaatcctgcgtctggtgatcctgttgtctgtgaagcgaag
gattccttcatgtgctcagtcgctcttgacactacaacaagctttgtcactgtggtgact
gtcagcatctccaacgctgtagctctgccggtcctgctcagagttcctgcccgacctgtg
aaacctggtcctccagtcaacctttcccacacgcagaccatcgaggcagaactgatttta
cactgggacgacccaccagactttactgatactggccttctgagatatgaggtccgatac
tcctttaacaccactaatccagcctggcaggtggtgtctgcacccacagagcccagactg
tctctggatctgaagcccagactgaactacaccatccaggttcgctgctccggcctggaa
gagccgccactgtggagcgagtggagtgaaagtcaccacatctacctggacacggtgagc
tacatccctgagaaagttgtggcgcgaccgggggagaacgtaacggtgtattgtgtgttc
aacgatcacagcatcaacgccagcacggccatgtggatgctcaacttccagcagccgctt
catcgcagccagtaccaccccatcaaccagtgggtcagccagatcacagtgcgtccttca
gagactcggatgtatgacctgctgcagtgcactcaggagtggaccatcccttacagccag
atctatgtggagggagcttccattgatatcaactgtgaaaccaacggtgacatcgatgct
atggactgcagctggaagaacacacagtggactaaacccaaatttcgatccaggtgggct
gacctgtcgtgcgatgtgatggaggaaagggagcgagcgggtgagaaagtgggggagatg
gggcctgcttgcctgccggtcagatccagggagaaaagctgcaccatccagcctctgagg
atgaactgctacaagctgtggctggaggtgtcgtcccgtctgggccccatcagatccaaa
cccgtctacctgtcgcccatagatcatgtgaaaccccacacacccactaatgtgaaggca
gtgagccggagcagtggggtcctgacggtcacttgggagcctccgtctctgccggtccag
gggctccagtgtcagtttcggtaccactcgccgtccatggtgagagcccagccggagtgg
aaggtccagagtccggtgcgtgttccttcggcggaggttgtggtgccggacatgtgccgg
gtgtatgcggtgcaagtgcgctgcatgcacatcaacatcagctactggagcgactggagc
gacctggcctactccactccacaaaacagcagagctcctgagcgtggccctgacttctgg
agagttcttcaagatgactcatacagaaaccagacaaatgtcacgctgctgtttgagagt
ctcccagtgtcggggcgctcctactgcgtggacggatttatagttcagcaccagttctcg
agcggcactgtgacgagggagtggatcgagccggtgtcctcctacagcttcgagtggaac
caggagctccacgccgtgaccgtggaggcctacaacagcctgggcagctccaccaacaac
atcaacatgacgctggagagacagcacaaacgccgctgtgtgcgttcgttccacgtgttg
gttatcaacagcacctgtgtgtctctgtcctggagcctgctggacaacagttctgttgtg
cctctgttcatggtggtgcagtggtctccacagaggcagcaggagtctgatcatcacaaa
gtccacagtggagaaacgtgggccagacttccctacactgaccgtcccgtctatctaaga
ggtgatttctttggctctgaggaatacggcttctacttgtaccctgtgtttgctgatgga
gaaggggagccgatgcacgctatggctgccagaggatatcctgcagcctacatgatgctg
atgataatctccttcctttcagtcgtcctgttcgtcactctggtcctctcccaaaaccag
atgaaaaggtttgtgtggaaggatgtacccaacccaaacaagtgctcgtgggctaaagga
ctagacttcaaaaagactgacacctttgaccacctgttccaacccccagacggcctgcca
gcctggccgctgctgctgcccactgagaacatctccaaagtcgtcataatggacaaagct
gacctctcagctctgaccacagctctggtccaaaccccacttgtatccctgactcccgac
ccagtcactgacttagctatctccgttcctccagggtttgactcggaggtcgaccaaacc
cacttcatagagagtgaggtgctaatggatggagctcctcccttagcccttaatctggat
gctttaaccagttcacatccagggatagatgacttgcagccagtcgatcccccgggagac
cagccgccaagcagcactgacagctctgcccagtcttcagtcacatatgccaccgtgctg
ctgtctggtgcgaagcagaagcaacagtccattcacctccactacaaggacggtagtggc
agcagctccagtgacgagggcaacttctctgccaacaactctgacatttcaggatctttc
cccggtggtctgtgggagctggacagctgccggggtggggagatggacgacccgcggcac
tcctgctcgtacaactctgtggaagagctttctgaaacatcggagcaagaagatgaaggg
gaggtgagagaagagaaggacttgttttatctgggaatggactatccagcggaggatgag
gagagtgaggaggaagaggagcagcagacggaagaggagacaaaaattgggctgcttaaa
aaggtagttttgaacagagaagactgtcccgtggagacgcaccatttgctcggccctgag
gaatcgagcgagcgcacagagcggcggtcagcgtcgacgcgcggcttttccccgctctac
ctgcctcagttcagaactgctccatgcacgaggcaactacaagacagcaaaccccagctg
tga

DBGET integrated database retrieval system