KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111645377
Entry
111645377         CDS       T06058                                 

Gene name
acsbg2
Definition
(RefSeq) long-chain-fatty-acid--CoA ligase ACSBG2 isoform X1
  KO
K15013  long-chain-fatty-acid--CoA ligase ACSBG [EC:6.2.1.3]
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal00061  Fatty acid biosynthesis
slal00071  Fatty acid degradation
slal01100  Metabolic pathways
slal01212  Fatty acid metabolism
slal03320  PPAR signaling pathway
slal04920  Adipocytokine signaling pathway
Module
slal_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:slal00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    111645377 (acsbg2)
   00071 Fatty acid degradation
    111645377 (acsbg2)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    111645377 (acsbg2)
   03320 PPAR signaling pathway
    111645377 (acsbg2)
Enzymes [BR:slal01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     111645377 (acsbg2)
Lipid biosynthesis proteins [BR:slal01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   111645377 (acsbg2)
SSDB
Motif
Pfam: AMP-binding
Other DBs
NCBI-GeneID: 111645377
NCBI-ProteinID: XP_023250348
LinkDB
Position
Unknown
AA seq 766 aa
MQLTVCDPTAEAVVMEPPRAGGVLESSCGAGDSAASLDDVAVDAANESSEEESTGEREEE
IGAHNEVSTSNTKTTKVPAEQTSNTQTVNAQRPNSLSVPAAAAPGLCTSQGDAEVKLRMG
DSGLAAETPLTVNQMFTSAVERFGNYTALGWKEGEQQKTLNYRDYYQTCRTAAKSFLKLG
LQHYHGVGILGFNSAEWFIADIGAILAGGFAVGIYTTNSPEACQYVAENCKANIIVVENH
KQLQKILQVEDKLPHLKAIIQYKDALKEKRPNLYTWAEFMELGRDEPDAPLDAIISRQKP
NQCCTLIYTSGTTGQPKGVMLSHDNLTWTALSTSRHVRLTDANQAQEVVVSYLPLSHIAA
QMVDIWVTMRVGGATYFAQPDALKGSLVNTLKEVRPTAFMGVPRVWEKMQEKMKSAGAKS
STVRRKVAAWAKDVGLQTNLTKMNQNREAGRTPFSYHIAKKLVFKKVRKALGLDRCNKCY
TGAAPITKDTLEFFLSLDIPLYELYGMSESTGPHTISLPDAFKLTSCGKEIPGCKTKLHN
PDEEGNGEICFWGRHVFMGYLNMPEKTEEALDAEGWLHSGDLGKHDQNGFLFITGRIKEL
IITAGGENIPPVPIEDAVKEAVPLISNAMLIGDKRKFLSMLLTIKCQVNADTGDPEDELA
PEAVEFCKRLSSNATRVSEITGGRDRAIHTAIQEGINRVNEKATSNAQRIQKWIVLDRDF
SVGGGELGPTMKLKRPVVVKMYKEQIENFYKELATPTTPDNPLPPK
NT seq 2301 nt   +upstreamnt  +downstreamnt
atgcaattgaccgtgtgtgatcccaccgctgaagctgtggtgatggagcctcccagagcg
ggcggtgtcctggagtcatcctgtggtgcaggagacagcgcagcctctcttgatgacgtc
gctgtggatgcagccaatgagtcttcagaggaagagtccacaggggaaagagaagaggag
attggtgcccataatgaagtcagcaccagcaacaccaagactacaaaggtccctgctgaa
cagacctcaaacacacaaacagtgaatgcccagcgcccaaactccctgtccgtgccagca
gcagcagcgcccggcctgtgcacgtcacagggcgatgcggaggtgaaactgaggatgggg
gactctggcctggctgctgagacacccctgactgtcaaccagatgttcacctcagctgtg
gagcgctttgggaactacacagctctgggctggaaggagggtgagcagcagaagaccctg
aactacagagactactaccagacctgccgcaccgccgccaagagcttcctcaagcttggt
ctgcagcactaccacggcgtcggcatcctgggcttcaactcagctgagtggttcattgcg
gatattggagcgattttggcaggtgggtttgctgtgggcatctacaccaccaattctccg
gaggcatgtcagtatgtagcagaaaactgcaaggccaatatcattgtagtggagaaccac
aaacagctgcagaaaatccttcaggttgaagacaagcttcctcacttgaaagccattatc
cagtacaaagatgcactaaaagagaagagaccaaatctgtacacatgggcagagtttatg
gagcttggacgtgatgagcctgacgctcccctcgatgccatcatctccaggcagaagccc
aaccaatgctgcacgctcatctacacctcaggaaccacaggccagcccaaaggagtcatg
ctgagccatgacaatctaacatggaccgcgctctccaccagccgtcatgtgcgcctgaca
gacgccaaccaggctcaggaggtggtggtcagctacctgccgctcagccacatcgcagct
cagatggtggacatctgggtcaccatgagggtcgggggggcgacgtacttcgctcagcca
gatgccctcaagggctctctggtaaacaccttgaaggaggtgcgtcccacagccttcatg
ggcgtccctcgtgtctgggaaaagatgcaggagaagatgaaatctgctggagcaaagtct
tccactgtgcgcaggaaagtggctgcttgggccaaagatgtcggtttgcagactaatctc
accaagatgaaccaaaacagagaagctggccgcacaccgttcagctatcacatagccaaa
aagcttgtgttcaaaaaggtgcgtaaggccctgggcttggaccgctgcaacaagtgctac
acaggcgccgcacccatcaccaaagacaccctggagttcttcctcagcctggatattcct
ctgtacgagctgtacggcatgagtgagagcactggacctcacaccatctccctccctgat
gccttcaagctcaccagctgtggtaaagagatcccagggtgtaagacgaagctgcacaac
ccagacgaggagggaaacggagagatctgcttctggggtcgccacgtattcatgggttac
ctcaacatgcctgagaagacagaggaggctctggatgcagagggctggcttcactcaggt
gacctgggcaaacacgaccagaacggattcctcttcatcaccggaagaattaaagagctg
atcatcacagcaggaggagagaacatccctcctgtccccatcgaggatgcagtgaaagag
gccgtgccgctgattagcaacgccatgctgattggagacaagaggaagtttctgtctatg
ctgctcaccattaagtgccaggtgaacgctgacacaggcgatccagaggacgagctggca
ccagaggcagtggagttctgcaagaggctgagcagcaacgccacgcgtgtttctgagatc
acaggcggccgagaccgtgcgatccacaccgccatccaggaggggattaacagagtcaat
gagaaggcaacctccaacgctcaacgcatccagaagtggattgttctggatcgggacttc
tctgttggtggaggagagctaggccctaccatgaagctgaagcgtccagtggtggtgaag
atgtacaaggagcagattgagaacttttacaaggagctggcgactccgacgactcccgac
aacccactgcctcccaaatag

KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111646477
Entry
111646477         CDS       T06058                                 

Definition
(RefSeq) long-chain-fatty-acid--CoA ligase 4-like
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal00061  Fatty acid biosynthesis
slal00071  Fatty acid degradation
slal01100  Metabolic pathways
slal01212  Fatty acid metabolism
slal03320  PPAR signaling pathway
slal04146  Peroxisome
slal04216  Ferroptosis
slal04920  Adipocytokine signaling pathway
Module
slal_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:slal00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    111646477
   00071 Fatty acid degradation
    111646477
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    111646477
  09143 Cell growth and death
   04216 Ferroptosis
    111646477
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    111646477
   03320 PPAR signaling pathway
    111646477
Enzymes [BR:slal01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     111646477
Lipid biosynthesis proteins [BR:slal01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   111646477
Exosome [BR:slal04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   111646477
  Exosomal proteins of breast cancer cells
   111646477
SSDB
Motif
Pfam: AMP-binding AMP-binding_C
Other DBs
NCBI-GeneID: 111646477
NCBI-ProteinID: XP_023251748
LinkDB
Position
Unknown
AA seq 712 aa
MGLQADSALQSILLFPIHLLVWLYSVLSFLPWYYVTGAGQRQALSKRIKARSISGRAEGP
YRSVDHFDCLAREDFPGKDTLDKLFEYAVQRFGETHCLGTRDILSEENEIQPSGKVFKKL
ILGEYKWLSYNELDSIVSQFGSGLAALGQQPKSTIAIFCETRAEWMITAQACFRRNFPLV
TFYATLGEDAIAYGLNETGVTHLVTSVELLETKLKNVLPQIPKLKHVIYVDQKKASTEGY
PAGLSIHSMEAVRELGALPENMGRAIVKPQPADLAVVMYTSGSTGRPKGVMIVHSNLIAG
MTGQCERIPGLGPNDTYIAYLPLAHVLEMTAEISCVTYGCRIGYSSPQTLSDQSTKIKKG
SKGDSSVLRPTLMAAVPEIMDRINKNVMSKVQEMSFIQKTLFTLGYKYKLEQIKRGYDAP
LCNALLFRKVKKLLGGRVRMMLSGGAPLSSATQRFMNVCFCCPVGQGYGLTETCGAGTIT
EVVDISTGRVGAPLICCEVILRDWAEGGYTSKDEPNPRGEILIGGPNVTMGYYRNESKDQ
DFFVDEKGQRWFCTGDVGEIYPDGCLQIVDRKKDLVKLQAGEYVSLGKVESALKSCPLID
NICAYANSDQNYVISFVVPNQKKLTEMAKQRGIVGTWEEICTHPDMEREVLKEIKVVAAN
IKLQRFEIPVKVHLSPEPWTPETGLVTDAFKLKRKELKNHYLYHIERMYGGK
NT seq 2139 nt   +upstreamnt  +downstreamnt
atgggtcttcaggcagactcagcactccaatctattctcctctttccaatccaccttctg
gtatggctgtactccgtcctgtcctttctaccctggtactacgtcaccggtgccgggcag
agacaagctttgtccaagcggataaaggcccgctccatctcaggccgtgctgagggacca
taccgatctgtggaccatttcgactgcctggccagggaggacttcccaggcaaggacacg
ctggataagcttttcgagtatgctgtacagcgatttggagaaacacattgtctcggtacc
cgagatattctgagtgaagagaatgagattcaacccagtggtaaagtttttaaaaagctg
atccttggggagtataaatggctgtcctacaatgaactggattctatagtgagtcagttt
ggcagtggattggcagctctcggacaacagcccaaaagcaccattgcaatcttctgtgaa
accagagcagagtggatgatcactgcccaggcgtgcttcaggcgtaatttcccattggta
acattctatgccacattgggagaggatgctattgcatatggactgaatgagactggtgtt
acacatctagtcaccagtgtggagctgcttgagactaaattgaaaaatgtgcttccacag
atcccaaaactgaagcatgtgatctacgtggaccagaagaaagcgagcacagaaggctac
ccagcaggactctccatccacagcatggaggctgtacgagagctgggcgcgctgcctgaa
aatatggggagggcaattgtgaagccccagcctgctgatctggctgtggtgatgtacacc
agtggctccacaggcagacccaaaggagtcatgattgtccacagtaacctgatcgcagga
atgacaggacagtgtgagcgcatccctggtctcgggcctaatgatacttacatagcctac
ctgccgctggctcatgttctggaaatgacagctgaaatctcctgtgtcacatatggctgt
cggatcggctactcatccccgcagacactgtcagaccagtccaccaagataaagaaagga
agtaaaggagacagctcagtactcagacccacactgatggcagctgtgccagaaattatg
gatcgcatcaacaagaacgtgatgagcaaagtgcaggaaatgagtttcattcagaagact
ctgtttactctgggctacaagtataaactagagcagatcaagcggggctatgacgcacca
ctctgcaatgccctcttattccggaaagtcaagaaacttctgggaggaagagtgaggatg
atgttgtcaggaggagccccgctgtcctcagccactcaaagatttatgaatgtatgtttc
tgttgtccagtgggccagggctatggtctcacagaaacctgtggagcaggcaccatcaca
gaggttgtggacatcagcactggtcgcgttggagctcctctcatatgctgtgaggtcatt
ctcagggactgggctgaaggtggatacaccagcaaagacgagccgaacccaagaggggag
atcctgatcggtggtcccaatgtaaccatgggttactacaggaatgaaagcaaagatcag
gacttttttgtggatgaaaaagggcagagatggttctgcactggtgatgtaggagagatt
tacccagatggctgtctacaaatagtggaccgcaagaaagacttggtcaaactgcaggct
ggggagtatgtgtctcttggtaaagtcgaatctgcgctgaaaagctgccctctcatagac
aacatttgtgcatacgcaaacagtgaccagaactatgtgatcagctttgtggttcccaac
cagaaaaagttgacagaaatggccaaacagagaggcattgtgggaacatgggaggagatc
tgcactcaccccgacatggaaagagaagttctgaaggagatcaaagttgttgctgctaac
attaaactccagcgatttgagattccagtgaaggtacatctcagtccagagccgtggacc
ccagagaccggacttgtgacagatgcgttcaagttgaagaggaaagagctgaagaaccac
tatctctaccacatagagagaatgtacgggggcaaataa

KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111651836
Entry
111651836         CDS       T06058                                 

Definition
(RefSeq) long-chain-fatty-acid--CoA ligase 4-like
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal00061  Fatty acid biosynthesis
slal00071  Fatty acid degradation
slal01100  Metabolic pathways
slal01212  Fatty acid metabolism
slal03320  PPAR signaling pathway
slal04146  Peroxisome
slal04216  Ferroptosis
slal04920  Adipocytokine signaling pathway
Module
slal_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:slal00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    111651836
   00071 Fatty acid degradation
    111651836
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    111651836
  09143 Cell growth and death
   04216 Ferroptosis
    111651836
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    111651836
   03320 PPAR signaling pathway
    111651836
Enzymes [BR:slal01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     111651836
Lipid biosynthesis proteins [BR:slal01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   111651836
Exosome [BR:slal04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   111651836
  Exosomal proteins of breast cancer cells
   111651836
SSDB
Motif
Pfam: AMP-binding AMP-binding_C
Other DBs
NCBI-GeneID: 111651836
NCBI-ProteinID: XP_023257657
LinkDB
Position
Unknown
AA seq 712 aa
MGLQADSALQSILLFPIHLLVWLYSVLSFLPWYYVTGAGQRQALSKRIKARSISGRAEGP
YRSVDHFDCLAREDFPGKDTLDKLFEYAVQRFGETHCLGTRDILSEENEIQPSGKVFKKL
ILGEYKWLSYNELDSIVSQFGSGLAALGQQPKSTIAIFCETRAEWMITAQACFRRNFPLV
TFYATLGEDAIAYGLNETGVTHLVTSVELLETKLKNVLPQIPKLKHVIYVDQKKASTEGY
PAGLSIHSMEAVRELGALPENMGRAIVKPQPADLAVVMYTSGSTGRPKGVMIVHSNLIAG
MTGQCERIPGLGPNDTYIAYLPLAHVLEMTAEISCVTYGCRIGYSSPQTLSDQSTKIKKG
SKGDSSVLRPTLMAAVPEIMDRINKNVMSKVQEMSFIQKTLFTLGYKYKLEQIKRGYDAP
LCNALLFRKVKKLLGGRVRMMLSGGAPLSSATQRFMNVCFCCPVGQGYGLTETCGAGTIT
EVVDISTGRVGAPLICCEVILRDWAEGGYTSKDEPNPRGEILIGGPNVTMGYYRNESKDQ
DFFVDEKGQRWFCTGDVGEIYPDGCLQIVDRKKDLVKLQAGEYVSLGKVESALKSCPLID
NICAYANSDQNYVISFVVPNQKKLTEMAKQRGIVGTWEEICTHPDMEREVLKEIKVVAAN
IKLQRFEIPVKVHLSPEPWTPETGLVTDAFKLKRKELKNHYLYHIERMYGGK
NT seq 2139 nt   +upstreamnt  +downstreamnt
atgggtcttcaggcagactcagcactccaatctattctcctctttccaatccaccttctg
gtatggctgtactccgtcctgtcctttctaccctggtactacgtcaccggtgccgggcag
agacaagctttgtccaagcggataaaggcccgctccatctcaggccgtgctgagggacca
taccgatctgtggaccatttcgactgcctggccagggaggacttcccaggcaaggacacg
ctggataagcttttcgagtatgctgtacagcgatttggagaaacacattgtctcggtacc
cgagatattctgagtgaagagaatgagattcaacccagtggtaaagtttttaaaaagctg
atccttggggagtataaatggctgtcctacaatgaactggattctatagtgagtcagttt
ggcagtggattggcagctctcggacaacagcccaaaagcaccattgcaatcttctgtgaa
accagagcagagtggatgatcactgcccaggcgtgcttcaggcgtaatttcccattggta
acattctatgccacattgggagaggatgctattgcatatggactgaatgagactggtgtt
acacatctagtcaccagtgtggagctgcttgagactaaattgaaaaatgtgcttccacag
atcccaaaactgaagcatgtgatctacgtggaccagaagaaagcgagcacagaaggctac
ccagcaggactctccatccacagcatggaggctgtacgagagctgggcgcgctgcctgaa
aatatggggagggcaattgtgaagccccagcctgctgatctggctgtggtgatgtacacc
agtggctccacaggcagacccaaaggagtcatgattgtccacagtaacctgatcgcagga
atgacaggacagtgtgagcgcatccctggtctcgggcctaatgatacttacatagcctac
ctgccgctggctcatgttctggaaatgacagctgaaatctcctgtgtcacatatggctgt
cggatcggctactcatccccgcagacactgtcagaccagtccaccaagataaagaaagga
agtaaaggagacagctcagtactcagacccacactgatggcagctgtgccagaaattatg
gatcgcatcaacaagaacgtgatgagcaaagtgcaggaaatgagtttcattcagaagact
ctgtttactctgggctacaagtataaactagagcagatcaagcggggctatgacgcacca
ctctgcaatgccctcttattccggaaagtcaagaaacttctgggaggaagagtgaggatg
atgttgtcaggaggagccccgctgtcctcagccactcaaagatttatgaatgtatgtttc
tgttgtccagtgggccagggctatggtctcacagaaacctgtggagcaggcaccatcaca
gaggttgtggacatcagcactggtcgcgttggagctcctctcatatgctgtgaggtcatt
ctcagggactgggctgaaggtggatacaccagcaaagacgagccgaacccaagaggggag
atcctgatcggtggtcccaatgtaaccatgggttactacaggaatgaaagcaaagatcag
gacttttttgtggatgaaaaagggcagagatggttctgcactggtgatgtaggagagatt
tacccagatggctgtctacaaatagtggaccgcaagaaagacttggtcaaactgcaggct
ggggagtatgtgtctcttggtaaagtcgaatctgcgctgaaaagctgccctctcatagac
aacatttgtgcatacgcaaacagtgaccagaactatgtgatcagctttgtggttcccaac
cagaaaaagttgacagaaatggccaaacagagaggcattgtgggaacatgggaggagatc
tgcactcaccccgacatggaaagagaagttctgaaggagatcaaagttgttgctgctaac
attaaactccagcgatttgagattccagtgaaggtacatctcagtccagagccgtggacc
ccagagaccggacttgtgacagatgcgttcaagttgaagaggaaagagctgaagaaccac
tatctctaccacatagagagaatgtacgggggcaaataa

KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111653979
Entry
111653979         CDS       T06058                                 

Definition
(RefSeq) long-chain-fatty-acid--CoA ligase 4-like
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal00061  Fatty acid biosynthesis
slal00071  Fatty acid degradation
slal01100  Metabolic pathways
slal01212  Fatty acid metabolism
slal03320  PPAR signaling pathway
slal04146  Peroxisome
slal04216  Ferroptosis
slal04920  Adipocytokine signaling pathway
Module
slal_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:slal00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    111653979
   00071 Fatty acid degradation
    111653979
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    111653979
  09143 Cell growth and death
   04216 Ferroptosis
    111653979
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    111653979
   03320 PPAR signaling pathway
    111653979
Enzymes [BR:slal01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     111653979
Lipid biosynthesis proteins [BR:slal01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   111653979
Exosome [BR:slal04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   111653979
  Exosomal proteins of breast cancer cells
   111653979
SSDB
Motif
Pfam: AMP-binding AMP-binding_C
Other DBs
NCBI-GeneID: 111653979
NCBI-ProteinID: XP_023260553
LinkDB
Position
Unknown
AA seq 712 aa
MGLQADSALQSILLFPIHLLVWLYSVLSFLPWYYVTGAGQRQALSKRIKARSISGRAEGP
YRSVDHFDCLAREDFPGKDTLDKLFEYAVQRFGETHCLGTRDILSEENEIQPSGKVFKKL
ILGEYKWLSYNELDSIVSQFGSGLAALGQQPKSTIAIFCETRAEWMITAQACFRRNFPLV
TFYATLGEDAIAYGLNETGVTHLVTSVELLETKLKNVLPQIPKLKHVIYVDQKKASTEGY
PAGLSIHSMEAVRELGALPENMGRAIVKPQPADLAVVMYTSGSTGRPKGVMIVHSNLIAG
MTGQCERIPGLGPNDTYIAYLPLAHVLEMTAEISCVTYGCRIGYSSPQTLSDQSTKIKKG
SKGDSSVLRPTLMAAVPEIMDRINKNVMSKVQEMSFIQKTLFTLGYKYKLEQIKRGYDAP
LCNALLFRKVKKLLGGRVRMMLSGGAPLSSATQRFMNVCFCCPVGQGYGLTETCGAGTIT
EVVDISTGRVGAPLICCEVILRDWAEGGYTSKDEPNPRGEILIGGPNVTMGYYRNESKDQ
DFFVDEKGQRWFCTGDVGEIYPDGCLQIVDRKKDLVKLQAGEYVSLGKVESALKSCPLID
NICAYANSDQNYVISFVVPNQKKLTEMAKQRGIVGTWEEICTHPDMEREVLKEIKVVAAN
IKLQRFEIPVKVHLSPEPWTPETGLVTDAFKLKRKELKNHYLYHIERMYGGK
NT seq 2139 nt   +upstreamnt  +downstreamnt
atgggtcttcaggcagactcagcactccaatctattctcctctttccaatccaccttctg
gtatggctgtactccgtcctgtcctttctaccctggtactacgtcaccggtgccgggcag
agacaagctttgtccaagcggataaaggcccgctccatctcaggccgtgctgagggacca
taccgatctgtggaccatttcgactgcctggccagggaggacttcccaggcaaggacacg
ctggataagcttttcgagtatgctgtacagcgatttggagaaacacattgtctcggtacc
cgagatattctgagtgaagagaatgagattcaacccagtggtaaagtttttaaaaagctg
atccttggggagtataaatggctgtcctacaatgaactggattctatagtgagtcagttt
ggcagtggattggcagctctcggacaacagcccaaaagcaccattgcaatcttctgtgaa
accagagcagagtggatgatcactgcccaggcgtgcttcaggcgtaatttcccattggta
acattctatgccacattgggagaggatgctattgcatatggactgaatgagactggtgtt
acacatctagtcaccagtgtggagctgcttgagactaaattgaaaaatgtgcttccacag
atcccaaaactgaagcatgtgatctacgtggaccagaagaaagcgagcacagaaggctac
ccagcaggactctccatccacagcatggaggctgtacgagagctgggcgcgctgcctgaa
aatatggggagggcaattgtgaagccccagcctgctgatctggctgtggtgatgtacacc
agtggctccacaggcagacccaaaggagtcatgattgtccacagtaacctgatcgcagga
atgacaggacagtgtgagcgcatccctggtctcgggcctaatgatacttacatagcctac
ctgccgctggctcatgttctggaaatgacagctgaaatctcctgtgtcacatatggctgt
cggatcggctactcatccccgcagacactgtcagaccagtccaccaagataaagaaagga
agtaaaggagacagctcagtactcagacccacactgatggcagctgtgccagaaattatg
gatcgcatcaacaagaacgtgatgagcaaagtgcaggaaatgagtttcattcagaagact
ctgtttactctgggctacaagtataaactagagcagatcaagcggggctatgacgcacca
ctctgcaatgccctcttattccggaaagtcaagaaacttctgggaggaagagtgaggatg
atgttgtcaggaggagccccgctgtcctcagccactcaaagatttatgaatgtatgtttc
tgttgtccagtgggccagggctatggtctcacagaaacctgtggagcaggcaccatcaca
gaggttgtggacatcagcactggtcgcgttggagctcctctcatatgctgtgaggtcatt
ctcagggactgggctgaaggtggatacaccagcaaagacgagccgaacccaagaggggag
atcctgatcggtggtcccaatgtaaccatgggttactacaggaatgaaagcaaagatcag
gacttttttgtggatgaaaaagggcagagatggttctgcactggtgatgtaggagagatt
tacccagatggctgtctacaaatagtggaccgcaagaaagacttggtcaaactgcaggct
ggggagtatgtgtctcttggtaaagtcgaatctgcgctgaaaagctgccctctcatagac
aacatttgtgcatacgcaaacagtgaccagaactatgtgatcagctttgtggttcccaac
cagaaaaagttgacagaaatggccaaacagagaggcattgtgggaacatgggaggagatc
tgcactcaccccgacatggaaagagaagttctgaaggagatcaaagttgttgctgctaac
attaaactccagcgatttgagattccagtgaaggtacatctcagtccagagccgtggacc
ccagagaccggacttgtgacagatgcgttcaagttgaagaggaaagagctgaagaaccac
tatctctaccacatagagagaatgtacgggggcaaataa

KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111654481
Entry
111654481         CDS       T06058                                 

Definition
(RefSeq) long-chain-fatty-acid--CoA ligase 3-like
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal00061  Fatty acid biosynthesis
slal00071  Fatty acid degradation
slal01100  Metabolic pathways
slal01212  Fatty acid metabolism
slal03320  PPAR signaling pathway
slal04146  Peroxisome
slal04216  Ferroptosis
slal04920  Adipocytokine signaling pathway
Module
slal_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:slal00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    111654481
   00071 Fatty acid degradation
    111654481
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    111654481
  09143 Cell growth and death
   04216 Ferroptosis
    111654481
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    111654481
   03320 PPAR signaling pathway
    111654481
Enzymes [BR:slal01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     111654481
Lipid biosynthesis proteins [BR:slal01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   111654481
Exosome [BR:slal04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   111654481
  Exosomal proteins of breast cancer cells
   111654481
SSDB
Motif
Pfam: AMP-binding AMP-binding_C
Other DBs
NCBI-GeneID: 111654481
NCBI-ProteinID: XP_023261291
LinkDB
Position
Unknown
AA seq 711 aa
MKLKEDMNPLLLQVFRSVVWVYSVITFIPWYFFSGAGINLERARRIKARSISRHPAGPYR
AINSQEKLVAWLHPGVDTLDKMFEHAASRFPQRDCLGTREVLSEEDELQPNGKVFKKVIL
GNYNWLSYEEAYQAAKCFGSGLAALGQRPQCNIAIFCETRAEWIVAAQACFMYNFPLVTL
YATLGPTAIAHGLNETEVTHIITSKDLLHSRLKAILCDVPRLQYVIVVDSKPTSWPDIPR
GIMIYNMDAVKDMGSKPDNIAVDRRQPLSSDIAVIMYTSGSTGIPKGVMISHGNIMAGIT
GMAERIPNLNETDTYIGYLPLAHVLELSAELVCISHGCRIGYSSPQTLADQSTKIKKGSK
GDTSVLKPTLMAAVPEIMDRIYKNVMTKVEEMSRFQKTLFVLAYNYKMEQISKGYSTPLC
DSLVFKRVRALLGGNTRVLLSGGAPLSAATQRFMNICLCCPVGQGYGLTETCGAGTISEI
WDYSTGRVGAPLVCSEVTLKDWEEGGYYSTDKPNPRGEILIGGPNVTMGYYKNEVKNRED
FFVDENGQRWFCTGDIGEFHSDGCLKIIDRKKDLVKLQAGEYVSLGKVEAVLKNCPLIDN
ICAYANSDQSYVISFVVPNHKQLMALAEQMQVRGTWEEICNNSQMEKEVLCIITEAAISA
KLERFEIPKKIRLSSEPWTPETGLVTDAFKLKRKELKTHYQEDIERMYGGK
NT seq 2136 nt   +upstreamnt  +downstreamnt
atgaagttgaaggaggacatgaaccccctgctgttgcaggttttccgctctgtggtctgg
gtctactctgtcatcaccttcataccttggtacttcttctctggagctggcatcaatttg
gaacgggctcgccggatcaaggcgcgctcaattagcaggcacccggcagggccttacagg
gccatcaacagccaagagaagctggttgcatggctgcaccctggggtggacaccctggac
aaaatgtttgaacacgctgctagcaggtttccacagagagactgtcttggcacgcgggag
gtgctcagtgaggaggatgagctccagcctaacgggaaggtcttcaaaaaggtaattctg
gggaactacaactggctgtcatacgaggaagcataccaggcagcaaagtgttttggcagt
ggtcttgcagccctcggccagaggcctcagtgtaacatcgccatcttctgtgagaccaga
gcagagtggatcgtcgcagcacaagcttgcttcatgtacaatttcccacttgtgaccctg
tatgccactcttggacccacggccatcgcccatggcctgaacgagacagaggtcacacac
atcatcacaagcaaagacctgcttcatagccggcttaaggccatactgtgtgatgtgccc
agactgcaatatgtcattgtagttgacagtaaacccacaagctggccagacatccccaga
ggcatcatgatctacaacatggacgctgtgaaggacatgggatccaagcctgacaatata
gcggttgaccgcagacagccattgtcctcggacatcgccgtcatcatgtacacaagcggc
tccacaggcatccccaagggtgtcatgatctcccatggcaacatcatggctggcattact
ggcatggctgagcgaatccctaacctcaatgagacagacacctacattggctacctgccg
ttggcccacgttttagagctcagcgctgaactggtgtgcatctctcatggctgtcgcatc
ggctactcctcccctcagactttagccgaccagtccaccaagataaagaagggcagtaaa
ggggatacaagcgtgctgaaacctactctcatggctgccgtaccagagatcatggatcga
atctacaagaatgtgatgaccaaagtggaggagatgagcaggttccagaagacgctcttt
gtgttggcttacaactacaagatggagcagatctccaagggctacagcacgccgctctgc
gacagtctggtgttcaaacgggtgcgtgcgctcttgggaggaaacacacgcgtgctgctt
tctggcggagctccactctcggctgccacacagcgcttcatgaacatctgtctgtgctgc
cctgtggggcagggctacggcttgacggaaacctgtggagctggcaccatcagtgagatt
tgggactacagcacaggacgcgttggtgctccactggtttgttcagaggtcacactaaag
gactgggaggagggtggttactacagcacagacaagcccaaccctcgaggtgaaattttg
atcggtgggcccaatgtaacaatgggttattacaagaacgaagtcaagaaccgcgaggac
ttttttgtggatgagaacggccaaagatggttctgtactggagacattggagagtttcac
tccgacggatgcctcaagatcatcgaccgtaagaaggacctggtgaaattgcaggcagga
gagtacgtctctctgggaaaagtggaagctgttctgaagaactgccctctcattgacaac
atctgtgcctacgccaacagcgaccagtcatatgtgatcagctttgtggtgcctaaccac
aagcagctaatggcactggcagagcagatgcaggtgaggggcacatgggaggagatctgc
aacaactcccagatggagaaagaggtcctctgcatcattactgaggctgctatctcagcg
aaactggagagatttgagattcccaaaaagatccgactgagttctgagccgtggacacca
gagactggcttggtcactgacgcattcaaactgaaacgaaaggagctcaaaacacactac
caggaggacattgagcgaatgtatggtggaaaataa

KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111654910
Entry
111654910         CDS       T06058                                 

Definition
(RefSeq) long-chain-fatty-acid--CoA ligase ACSBG2-like
  KO
K15013  long-chain-fatty-acid--CoA ligase ACSBG [EC:6.2.1.3]
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal00061  Fatty acid biosynthesis
slal00071  Fatty acid degradation
slal01100  Metabolic pathways
slal01212  Fatty acid metabolism
slal03320  PPAR signaling pathway
slal04920  Adipocytokine signaling pathway
Module
slal_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:slal00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    111654910
   00071 Fatty acid degradation
    111654910
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    111654910
   03320 PPAR signaling pathway
    111654910
Enzymes [BR:slal01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     111654910
Lipid biosynthesis proteins [BR:slal01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   111654910
SSDB
Motif
Pfam: AMP-binding
Other DBs
NCBI-GeneID: 111654910
NCBI-ProteinID: XP_023261849
LinkDB
Position
Unknown
AA seq 759 aa
MSSQEDSRVSNDVAVMDGNTESIPSQKAQTLPESTNLKTHSTPIANGEATAAELSATSAS
AIQETRPSSKPEAATEAPSSHELEEAVEGLSLEEPKAVPLSSANVATTLAPADRLWSTSR
DEAVRLRMEGSGKASETPMTIHQMFLQTVDSSGDIPALVSKKEGQWETLTWRQYYEHCRA
AAKSFLKLGLERYHGVGILGFNSPEWFISDVGCILAGGLAAGIYTTNSPEACQYVAANCE
ANILVVENQKQLDKILQVKDQLPHLKAIVQYKGELQQKAPFLYTWAEFMKLGEDVPNEQL
DAVISSLRANECCTLIYTSGTTGKPKGVMLSHDNLTWTAHTAASLVDYTFASEAVISYLP
LSHVAAQMFDMWIAMTFAATIYFAEPDALKGSLATTMREVRPTYFLGVPRVWEKIQEKMR
AIGAKASPMRKRVADWAKSIGLQYNYSAMNGENLVPWGFMLANNLVFKKVRAALGLDRCK
ICFTGAAPITKETLDYFMSLNMPLMELYGMSESSGPHTVSVNSSYQMSSCGKVMPGCKTK
LENPDKEGNGEICFWGRNVFMGYLNMPDKTTEALDQDGWLHSGDLGRNDQQEFLYITGRI
KELIITAGGENIPPVPIEDALKAEVPIISNSMLLGDKLKFLSMLLTLKCVVDDNGDPTDE
LSPEALDFCQQHGVTATKVSEIIANKEPAIYNAIQEGVERVNAKATSNAQKVQKWVIVER
DFSVGGGELGPTMKLRRPIVVKMYQEKINEMYGVATDKQ
NT seq 2280 nt   +upstreamnt  +downstreamnt
atgagcagccaagaagattcacgtgtgagcaacgatgttgcggtcatggatggtaatact
gagagcatcccttcccaaaaagcacagactctgccagaatccaccaacttaaagacccac
tccactcccatcgctaacggagaagccacggcagctgagctcagtgcaacatcagcttcg
gcgatccaggagactcgtccttccagcaagcctgaggcagcgaccgaagctcccagctct
catgagctggaggaagctgttgaaggactttcactagaagagcccaaggcagttccactg
tcctcggcgaatgtggcaacgactctggccccagctgaccggctatggagcaccagcaga
gacgaggcagtcaggctgaggatggagggttcgggcaaagcctcggagactcccatgacc
atccatcagatgttcctgcagacggtggacagctctggggatattcctgccttggtttcc
aagaaagagggccagtgggagaccctgacgtggaggcaatactacgagcactgccgggca
gctgctaaaagttttctcaagttggggctggagcgttaccatggtgtggggattttagga
ttcaactcccctgagtggttcatctcagacgtcggctgcatcttggctgggggtctggca
gccggcatttacacgaccaactcgcccgaggcttgtcagtatgtggctgccaactgcgag
gccaacatcctggttgtggagaaccagaaacagctcgacaaaatcctgcaagttaaagat
cagctacctcatctgaaagccattgtccagtataaaggcgagctgcagcagaaagcacca
ttcttgtatacatgggcagagttcatgaagctgggagaggacgtgcccaacgagcagctg
gatgccgtgatcagcagtctccgggccaacgagtgctgcactctcatctatacctctgga
accactggaaaacctaaaggagtcatgctgagccacgacaatctgacatggacagcacat
acagcagctagcttggtggattataccttcgcttcggaggcggtgatcagttacttaccg
ctcagccacgtggcagcgcagatgtttgacatgtggattgctatgacttttgctgccacc
atctactttgcagagccagacgccctcaagggttccttagcaacaacaatgagagaggta
cgcccgacttatttcttgggggtccctcgagtgtgggagaagatacaggagaagatgaga
gcgattggtgccaaggcatccccaatgaggaagagggtggccgactgggccaagtccata
ggcctgcagtacaactacagtgccatgaacggagaaaatctggtgccgtggggtttcatg
ctggctaacaatttggtcttcaagaaggtgcgtgctgcgcttggcttagaccgctgcaag
atctgcttcacaggcgccgcccccatcaccaaagaaactctggactacttcatgagcctg
aacatgccgctgatggaactatacggcatgagcgaaagctccggcccacacaccgtctcg
gttaacagcagctaccagatgtcaagctgtgggaaggtgatgccaggctgcaagacaaag
ctggagaacccagacaaggaagggaacggagagatctgtttctggggtcggaacgtcttc
atgggctacctgaacatgcctgacaaaaccacagaggctcttgaccaggacggctggctg
cactccggagacctgggaagaaacgaccagcaggagttcctgtacatcacaggaaggatc
aaggagctgatcattaccgccggcggagagaacatccctcctgtgcccatcgaggatgca
ctgaaggccgaggtgccaatcatcagcaactccatgctgctgggagacaagctcaagttc
ctctccatgctactgaccctcaaatgcgtcgtcgacgacaacggtgaccccacggatgag
ctgagccctgaggctttggacttctgccagcagcacggcgtcacagccaccaaggtgtca
gagatcatagccaataaggagccagctatttacaacgccattcaggagggtgttgagcgc
gtcaacgccaaagcaacatctaacgcccagaaggtgcagaagtgggtcatagtggagcga
gacttctctgtcggtggaggagaactgggtcccaccatgaaactgaggaggcccattgtt
gtgaagatgtaccaggagaaaataaacgaaatgtatggagtggccacagacaaacagtag

KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111656174
Entry
111656174         CDS       T06058                                 

Gene name
acsl5
Definition
(RefSeq) long-chain-fatty-acid--CoA ligase 5
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal00061  Fatty acid biosynthesis
slal00071  Fatty acid degradation
slal01100  Metabolic pathways
slal01212  Fatty acid metabolism
slal03320  PPAR signaling pathway
slal04146  Peroxisome
slal04216  Ferroptosis
slal04920  Adipocytokine signaling pathway
Module
slal_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:slal00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    111656174 (acsl5)
   00071 Fatty acid degradation
    111656174 (acsl5)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    111656174 (acsl5)
  09143 Cell growth and death
   04216 Ferroptosis
    111656174 (acsl5)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    111656174 (acsl5)
   03320 PPAR signaling pathway
    111656174 (acsl5)
Enzymes [BR:slal01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     111656174 (acsl5)
Lipid biosynthesis proteins [BR:slal01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   111656174 (acsl5)
Exosome [BR:slal04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   111656174 (acsl5)
  Exosomal proteins of breast cancer cells
   111656174 (acsl5)
SSDB
Motif
Pfam: AMP-binding AMP-binding_C
Other DBs
NCBI-GeneID: 111656174
NCBI-ProteinID: XP_023263583
LinkDB
Position
Unknown
AA seq 683 aa
MEFLIQLLFSPLPTPAIISLFALAAATLFYLNTRPSPLRSPTDLKHQTLGIKDGARKTAL
LEGNNNLMSFCYEDAKTLYEVFQRGLRVSGNGPCLGYRKPGRPYQWLKYKQVSDRAEHLG
SGLLHRGLKPDQDTFIGIFAQNRPEWIIGELACYTYSMVAVPLYDTLGPEALVFIIDRAE
ISTVLCDNQNKAETLLQNREKGQSPVLKTIVIMDPFNSELVERGTKCGVDIVSMQDVEAL
GKSNLQKPSPPKPEDLSIVCFTSGTTGDPKGAMLTHENVVSNAAGVVKSFETSVVPSTQD
VSISFLPLAHMFERVVQTVIYGSGAKVGFFQGDIRLLPDDMKTLQPTIFPVVPRLLNRVY
DKVQSGAKTPFKKWLLNFAVERKYAEVKEGIIRNNSMWDKLIFHKVQESLGGRVRVMVTG
AAPISPSVLNFLRASLGCQIFEAYGQTECTAGCTFTMPGDATSGHVGVPLPCNIVKLVDV
EEMNYFGSNGEGEVCIKGRNVFKGYLKDQEKTAEALDKDGWLHTGDIGKWLPTGVLKIID
RKKNIFKLAQGEYIAPEKIENVYVRSGPVAQVFVHGDSLQSCLVAIVVPDPEVLPGFANN
LGCQGSIEELCKNTEIKKAILSDMTKLGKEAGLKSFEQVKDLYLHPEQFTIENGLLTPTL
KAKRAELKALFQPQIDKLYANIQ
NT seq 2052 nt   +upstreamnt  +downstreamnt
atggaattccttatccagttgctgttctcccctctcccgaccccggccatcatctcgctg
tttgcactggcagccgccaccctgttttacctcaacacacgacccagtcctctccgcagc
ccgactgacctcaaacaccaaactctggggatcaaggatggagcaagaaagactgctttg
cttgagggcaacaacaacctgatgtcgttctgctacgaagacgccaagaccctctatgag
gtttttcagagggggctgagagtttcaggcaatggaccctgcttgggctacagaaaacca
ggaaggccgtaccagtggctgaagtacaaacaggtgtctgacagggcggagcacctgggg
tcagggctgcttcacagaggcctgaagccagaccaggacacttttatcggcatctttgcc
cagaacagacctgaatggattattggtgaactggcttgttacacctactccatggtagca
gttcccctgtacgacaccctgggtcctgaggctctcgtgttcattatcgaccgagcggag
atctccacagtgctttgtgacaaccaaaataaagcagaaaccctgctgcagaaccgggaa
aaaggccagagtcccgttctcaaaactatcgtcatcatggaccctttcaactccgagttg
gtcgagagaggaaccaagtgtggggtggacatcgtgtccatgcaggatgtggaggctctg
gggaaaagtaatcttcaaaagccaagtccaccaaagccagaggacctcagtattgtttgc
ttcaccagtggcacaacaggagacccaaagggagcaatgctgacccatgagaatgtggtg
tctaatgcagcaggtgttgtcaaaagctttgagacgtcagttgttccaagtacccaggat
gtcagcatttcatttctgcctttagctcacatgtttgagagagttgtccagacagtgatc
tacggttctggtgctaaggtgggattcttccagggtgacatcagactgctgccagatgac
atgaaaaccctgcagcccaccattttcccagtcgttccacggcttctcaaccgtgtctat
gacaaagtccagagtggagccaagacgcctttcaagaaatggcttctgaactttgctgtg
gagaggaaatatgccgaagtcaaggagggcatcatcaggaacaacagcatgtgggacaag
ctcatcttccacaaagttcaggagtctttggggggacgtgtgcgggtcatggtgactgga
gcagctcccatatctccctctgtgctcaacttcctcagggcttctctgggctgccagatc
tttgaggcatatggtcagacagagtgcacggccggctgcaccttcaccatgccgggagac
gccacttcaggacatgttggtgtgccactgccttgtaatattgtgaagttggtggatgtt
gaagaaatgaactactttggttcaaatggtgaaggggaggtctgtatcaagggtagaaat
gtgttcaaagggtacttgaaggaccaagagaagacagcagaggctttggataaagatggt
tggctccacactggggacattggaaaatggcttccgactggagttctgaagatcatcgac
cggaagaagaatatcttcaagctggctcagggggagtacatcgctccagagaagattgag
aatgtgtatgtacgcagtggacctgtggcccaagtgtttgtgcatggagacagcctacag
tcttgcctggttgccattgtggtccccgatcccgaggtcctgccgggttttgccaacaat
ctggggtgccaaggctccattgaagaactctgcaaaaacacagaaattaagaaagccatc
ctttcagacatgaccaaactgggtaaagaagcagggctcaagtcctttgagcaggtgaag
gatttgtacctccatccagagcagttcaccattgagaacggtctgttaactcccacactc
aaggccaagagggccgagctcaaagctctcttccagccgcagatcgacaaactgtacgct
aacatccaataa

KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111657379
Entry
111657379         CDS       T06058                                 

Gene name
acsl6
Definition
(RefSeq) long-chain-fatty-acid--CoA ligase 6
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal00061  Fatty acid biosynthesis
slal00071  Fatty acid degradation
slal01100  Metabolic pathways
slal01212  Fatty acid metabolism
slal03320  PPAR signaling pathway
slal04146  Peroxisome
slal04216  Ferroptosis
slal04920  Adipocytokine signaling pathway
Module
slal_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:slal00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    111657379 (acsl6)
   00071 Fatty acid degradation
    111657379 (acsl6)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    111657379 (acsl6)
  09143 Cell growth and death
   04216 Ferroptosis
    111657379 (acsl6)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    111657379 (acsl6)
   03320 PPAR signaling pathway
    111657379 (acsl6)
Enzymes [BR:slal01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     111657379 (acsl6)
Lipid biosynthesis proteins [BR:slal01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   111657379 (acsl6)
Exosome [BR:slal04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   111657379 (acsl6)
  Exosomal proteins of breast cancer cells
   111657379 (acsl6)
SSDB
Motif
Pfam: AMP-binding AMP-binding_C
Other DBs
NCBI-GeneID: 111657379
NCBI-ProteinID: XP_023265299
LinkDB
Position
Unknown
AA seq 702 aa
MLAFVLVSGSLWIILELSSTLMEKMQAQEMMSGLRIPEMDDIGQFFRSLPTSTLVGIGAL
TAVLAYWLATRPRPIKPPCSLLHQSEEVPHEDGGRRSMMGDSSKLLSHYHDDARTMYEVF
QRGLHISGDGPCLGSRLPNQPYKWMSYKEVTARAEHLGSGLLHQGCQPNPNQFIGVFSQN
RPEWIISELACYTYSMVVVPLYDTLGPDAIRFIINTADISTVICDKVEKAEVLLDNVERK
ETPGLQRIILMDAFDSALMERGKDCSVHVQAIQEVEALGREHYRKPIPPAPDDLSIVCFT
SGTTGNPKGVMLTHGNVVADFSGFLKVTDKVIFPNQDDCLISFLPLAHMFERLIESVVYC
HGGRIGFYQGDIRLLPDDMKALRPTIFPVVPRLLNRMYDKIFSQANSPLKRWLLNFAAKR
KGAEVSSGIIRSDSIWDKIFFSKIQASLGGRLRMIITGAAPTSPSVLGFLRAALGCQSDQ
IGHVGAPLPCNLIKLVDVPEKNYFASKGEGEVCVKGPNVFKGYLKDPERTAETLDADGWL
HTGDIGKWLPNGTLKIIDRKKHIFKLAQGEYISPEKIENIYIRSEPVAQLYVHGDSLQSC
LVGIVVPDPEVMPEWAKKKGILGTYKDLCKNTELKKAILEDLVRLGKGSGLHSFEQVKNI
YVHNEMFSIENGLLTPTLKAKRPELKEFFKGKIDQLYSSISM
NT seq 2109 nt   +upstreamnt  +downstreamnt
atgctcgcattcgttctggtctctgggtcgctctggattattttagagctgagttccacc
ctgatggagaagatgcaggcccaggagatgatgagcggcctgaggataccggagatggac
gatatcggccagttcttccgctccctgccaacatccacgctggtgggcatcggcgctctg
acggccgtgctggcgtactggctggccaccagaccccgccccatcaaaccaccctgcagc
cttctgcaccagtctgaggaggtgccgcatgaagatggaggtcgccggtccatgatgggc
gacagttccaagctgctgagtcattaccatgacgacgccaggaccatgtacgaggtcttc
cagagaggcctccacatatctggtgatggaccttgcttaggctcgcggctccctaaccag
ccttacaaatggatgtcctacaaagaggtgacagcccgggccgagcatctgggttcagga
ttgctgcaccaaggctgccagcccaaccccaaccagttcataggagtgttttcccagaac
cggccagagtggatcatctcagaactagcttgctacacctactccatggtggtggttccc
ctttatgacactctgggcccagacgccatacggttcatcattaatactgctgacatctcc
acggtcatctgcgacaaagtagagaaagctgaggtgctgctggacaacgttgagcggaag
gagactccaggcctgcaaagaatcatcctgatggatgccttcgactctgccctcatggag
cgcggcaaggactgcagcgtccatgtgcaggccatacaggaagtcgaggctctgggcaga
gagcactacagaaaacctataccaccagcaccggacgacctgtctattgtgtgtttcacc
agtggaaccacaggaaacccaaagggagtcatgcttacccatgggaacgtggtagctgat
ttctcaggcttcctcaaagtaacagataaagtcattttccccaaccaagatgattgcctc
atttccttcctgccactggcccacatgtttgagaggctcatcgagtctgtggtttactgc
catggagggcggatcggcttctatcagggcgacatccgtctcctcccagatgacatgaag
gccctacggcctaccattttccctgtggtgcctcgactactcaaccgcatgtacgacaag
atcttcagccaggctaacagcccattgaagcgttggctgctcaactttgctgctaagaga
aaaggtgctgaagtcagcagcgggatcattcgcagtgacagcatctgggacaaaatcttc
ttcagtaagattcaggccagcctgggaggaaggttgaggatgattataactggagcggct
cctacctcgcccagtgtcctgggattcctcagagcagctctgggatgccagtctgaccaa
ataggtcacgtcggggctccgctgccatgtaacctcattaaactggtggatgttcctgag
aagaactactttgcctctaagggagagggagaggtttgtgtgaagggaccaaatgtcttt
aagggctacctcaaagatccagagaggacagccgagacgctggatgcagacggctggctc
cacaccggagacattggaaaatggttacctaatggcacactgaagatcattgacaggaag
aagcatatcttcaagttggcgcagggcgagtacatctcccctgagaagatcgagaacatc
tacattagaagtgaacctgtggcacagctctatgttcatggagacagtctgcagtcctgt
ttggtgggcattgtggttcctgaccctgaagtcatgcccgaatgggccaagaagaaaggc
atattaggtacctacaaggacctctgtaaaaacacggaactaaagaaagcaatccttgaa
gacttggtacgtctgggcaagggcagtggcctccactcctttgagcaggtgaagaacatc
tacgtccacaacgagatgttctccattgaaaacggtctcctgactccaacactaaaggcc
aagagaccggagctgaaggagttcttcaaggggaagatcgaccagctctacagcagcatc
tccatgtga

KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111662439
Entry
111662439         CDS       T06058                                 

Definition
(RefSeq) long-chain-fatty-acid--CoA ligase 4-like
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal00061  Fatty acid biosynthesis
slal00071  Fatty acid degradation
slal01100  Metabolic pathways
slal01212  Fatty acid metabolism
slal03320  PPAR signaling pathway
slal04146  Peroxisome
slal04216  Ferroptosis
slal04920  Adipocytokine signaling pathway
Module
slal_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:slal00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    111662439
   00071 Fatty acid degradation
    111662439
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    111662439
  09143 Cell growth and death
   04216 Ferroptosis
    111662439
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    111662439
   03320 PPAR signaling pathway
    111662439
Enzymes [BR:slal01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     111662439
Lipid biosynthesis proteins [BR:slal01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   111662439
Exosome [BR:slal04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   111662439
  Exosomal proteins of breast cancer cells
   111662439
SSDB
Motif
Pfam: AMP-binding
Other DBs
NCBI-GeneID: 111662439
NCBI-ProteinID: XP_023272103
LinkDB
Position
Unknown
AA seq 470 aa
MAGKVGAFSDCFGGHKNLWETLVASAATHGPLQCAGVRKILEVVPEGGFEKLRMAPNYEW
MTYSEYFKTADSLGAGLAEAIPGLKANDTVVIYADTQRDWMLAAYACWRQGYVVGTIYAT
LGAEGAEYGINQSGCKAVVADSKLLKILALGDVAIVAPSIFVAAPAVLDKVLVGIKAKFA
ALPGILQGRVNAAIANGKCDYDSGGVQKLLGGNVELMKFVQTVFKCRVRQGYGLTETCAA
TCIALASDNTTAQGGYMNADKDNKEIGMPRGEILIGGPGVCDGYLVDPAAPDPDVVAKNR
DEFVTIDGQRYFCTGDVGQYTPEGNLMIIDRKKDLVKLQQGEYVALSKVENVLKTSQYTA
LPMVYALSSMSYCIALICPNEGPLMKLAASLGVSGDLGAVCEDAKVVAAVLKDITAECKK
GKLAKFEIPTKVILVAELWTPENELLTAVRKLKRREIVACHKAQIDKCYV
NT seq 1413 nt   +upstreamnt  +downstreamnt
atggccggcaaggtcggcgccttctctgattgcttcggcgggcacaaaaacctttgggag
acgctcgtcgcctcggcagcgacgcacggtcccctccagtgtgcgggcgtgcgcaagatt
ctcgaagtcgtgcccgaggggggcttcgaaaagctgcgcatggcgcccaactacgagtgg
atgacctactccgagtacttcaagacggccgactcgctcggcgccggcctcgccgaggcc
atccccggcctaaaggcgaacgacacggtggtcatctacgcagacacgcagcgcgactgg
atgctcgctgcgtacgcctgctggcggcaggggtacgtcgttgggacgatctacgcgacg
ctcggcgccgagggcgccgagtacggcatcaaccagtccggctgcaaggcggtcgtcgca
gactccaagctgctcaagatcctggcgctcggcgacgtggccatcgtcgcgccctccatc
ttcgtcgccgcaccggcggtgctcgacaaggttctcgtcggcatcaaggccaagttcgcc
gcgctgcctggaatcctgcaggggcgcgtcaacgccgcgatcgccaacggcaagtgcgac
tacgactcgggcggcgtgcagaagctgctcggcggcaacgtggagctgatgaagtttgtg
cagaccgtcttcaagtgccgcgtgcggcagggctacggcctcaccgagacgtgcgcggcc
acgtgcatcgccctcgcgagcgacaacaccacggcgcagggcggctacatgaacgccgac
aaggacaacaaggagatcggcatgccccgcggcgagatcctcatcggcgggccgggcgtg
tgcgacggctacctcgtcgacccggccgcgccggacccggacgtggtggcgaagaaccgc
gacgagttcgtgacgatcgacggccagcgctacttttgcaccggcgacgtcggccagtac
acgcccgagggcaacctgatgatcatcgatcgcaagaaggacctggtcaagctgcagcag
ggcgagtacgtcgccctctccaaggttgagaacgtgctcaagacgtcgcagtacacggcg
ctgccgatggtgtacgcgctttcctcgatgtcgtactgcatcgcgctcatctgcccaaac
gagggcccgctcatgaagctcgcggcctcgctcggcgtgtcgggagatctcggcgccgtc
tgcgaggacgcaaaggtggtcgccgccgtgctcaaggacatcaccgccgagtgcaagaag
ggcaagctcgccaagtttgagatcccgaccaaggtcatcctcgtcgccgagctctggacg
ccggagaacgagctgctcacggcggtgcgcaagctcaagcggcgcgagatcgtcgcgtgc
cacaaggcgcagatcgacaagtgctacgtctag

KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111663892
Entry
111663892         CDS       T06058                                 

Definition
(RefSeq) long-chain-fatty-acid--CoA ligase 1-like
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal00061  Fatty acid biosynthesis
slal00071  Fatty acid degradation
slal01100  Metabolic pathways
slal01212  Fatty acid metabolism
slal03320  PPAR signaling pathway
slal04146  Peroxisome
slal04216  Ferroptosis
slal04920  Adipocytokine signaling pathway
Module
slal_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:slal00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    111663892
   00071 Fatty acid degradation
    111663892
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    111663892
  09143 Cell growth and death
   04216 Ferroptosis
    111663892
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    111663892
   03320 PPAR signaling pathway
    111663892
Enzymes [BR:slal01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     111663892
Lipid biosynthesis proteins [BR:slal01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   111663892
Exosome [BR:slal04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   111663892
  Exosomal proteins of breast cancer cells
   111663892
SSDB
Motif
Pfam: AMP-binding AMP-binding_C Tachykinin
Other DBs
NCBI-GeneID: 111663892
NCBI-ProteinID: XP_023274039
LinkDB
Position
Unknown
AA seq 716 aa
MHFQEWLRSLRSSAGLKGSESEDLWSLLPSLPLSSFSLSSLSLSSSSLLGLGALASLTAY
WLVTRPRPMRPPCDLQAQSVAVNGDPSCRRSALLKDDSLLEFYYDDTKTAYDMFQRGLKI
SGNGPCLGFRKPGQPYQWISYTEVAEQAQVLGSGLLAKGCQPNPQQFVGIFAQNRPEWII
SELACYTYSMAVVPLYDTLGLEAMVHILNLAEISLVICDREEKAASLLENKEKGVTPKLS
CLVLFNNFSEAFVERAKASEVEVLKLEQLMDLGRQNLKDPVPPQPQDLAVVCFTSGTTGK
PKGAMITHGNIASNTSSVIKILEGSFVIQQEDVSISYLPLAHMFERMIQVSMFCHGARVG
FYQGDISLLMDDIKTLKPTFFPVVPRLLNRIYDKILGSVTSPLRRALLHYAVRRKQAELS
SGVVRNNSLWDKLVFNRIQASLGGNLRFALTASAPISPTVLSFLRATLGCLIFEGYGQTE
CTAGCTFSMPGDWSAGHVGAPLPCAMVKLVDIPDMKYYAKNGEGEICIRGPSVFRGYLRD
PERTADALDSDGWLHSGDVGQWLPNGTLRIIDRKKHIFKLSQGEYIAPEKIENVYMRCVP
VLQVFVHGDSLQSYLIGIVVPDPEVFVDWAKERGFVGSYEELCQNPDVKNAVLEDMKAVG
KEAGLKSFEQVKDLHLHPETFSVANGLLTPTLKSRRADIRRVFQEQISSMYSKTAI
NT seq 2151 nt   +upstreamnt  +downstreamnt
atgcatttccaggagtggttacggtcacttcgctccagtgcgggtctcaaaggttctgaa
tcagaggacctctggagtcttctgccgtctctgcctctgtcctccttctccctgtcctcc
ctgtctctatcgtcctcctctctgctgggtttaggagccctggcctctctcactgcgtac
tggctggtgacccgtcctcgacccatgcgtcctccctgtgatctgcaagcccagtctgta
gccgtaaatggagatccaagctgcaggcgatcggctcttcttaaagatgactcactgctg
gagttttactatgatgacaccaagacggcttatgacatgttccagagaggcctgaagatc
tcaggaaatggcccgtgccttggcttcaggaagccgggccagccctaccagtggatctcc
tacactgaggtggcagagcaggcgcaggtgctgggctctgggctgttggctaaaggctgc
cagccgaacccgcagcagtttgtcgggatatttgcacaaaacagaccagagtggataatc
tcagaactggcctgctacacttactccatggcggtggtgcctctctatgacaccctgggg
ctggaggccatggtccacatactcaacctggcggagatctctctggtgatctgtgaccgg
gaggagaaggcagcgtctctgttagagaacaaggagaaaggcgtgacgccgaagctctct
tgcctggttctctttaacaacttcagtgaagcctttgtggagagggcgaaggccagcgag
gtggaggttttgaaactggagcagctcatggacctgggaaggcagaacctcaaagatcct
gtgccgccccagccccaggatctggccgtggtttgcttcaccagtggaaccacagggaag
cccaagggagccatgatcacccacggcaacatcgcctccaacacttcctctgtcattaag
atcctggagggttcgtttgtgatccagcaagaggatgtgtcgatctcgtacctgccgctt
gcccacatgtttgagaggatgattcaggtctctatgttctgccatggggccagagtagga
ttctaccaaggggacatttctcttcttatggatgacattaaaactctcaaacccaccttc
tttcctgttgtgcctcgattactcaatcgcatctatgacaagatcctgggttctgtgacg
tctccgttgcgacgcgctttgcttcactacgccgtgaggagaaagcaggcggagctcagc
agcggtgttgtacgtaacaacagtctgtgggacaaactggtgttcaacaggattcaggcc
agtttaggaggtaatctacgctttgctctgaccgcttcagcacccatctcccccacagtg
ctgtccttcctcagagccactctgggctgtctgatatttgagggttatggtcagacagag
tgcactgcaggctgcactttctctatgccgggagactggagcgcaggtcacgttggtgct
cctttaccctgcgccatggtgaagctggttgacattcctgacatgaaatactatgcaaag
aatggagagggagagatctgcatccgtggccccagtgtgttcagaggctacttgagggac
ccggaaaggacagctgacgccttggacagcgacggctggctgcacagcggggatgtgggc
cagtggcttccaaacgggacactacgcatcattgacagaaagaagcacatcttcaagttg
tcccagggagagtacatcgctccggagaagatagaaaacgtctacatgcgttgtgttcct
gtgctccaggtgttcgtgcatggagatagtttacagtcttatctcataggcatagtcgtg
cctgaccctgaggtgtttgttgactgggctaaagagcggggatttgtggggtcctatgag
gagctgtgccagaatcctgatgtaaagaatgcagtattagaggacatgaaagccgtgggg
aaagaagcagggctgaagtcatttgaacaagtgaaggaccttcacttgcatccagagacg
ttcagtgtcgccaacggcctcctcacacccaccctgaaaagtagacgtgccgacatccgt
agagtctttcaggaacagatatcaagcatgtacagtaaaacagccatttaa

KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111664013
Entry
111664013         CDS       T06058                                 

Definition
(RefSeq) long-chain-fatty-acid--CoA ligase 1-like isoform X1
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal00061  Fatty acid biosynthesis
slal00071  Fatty acid degradation
slal01100  Metabolic pathways
slal01212  Fatty acid metabolism
slal03320  PPAR signaling pathway
slal04146  Peroxisome
slal04216  Ferroptosis
slal04920  Adipocytokine signaling pathway
Module
slal_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:slal00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    111664013
   00071 Fatty acid degradation
    111664013
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    111664013
  09143 Cell growth and death
   04216 Ferroptosis
    111664013
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    111664013
   03320 PPAR signaling pathway
    111664013
Enzymes [BR:slal01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     111664013
Lipid biosynthesis proteins [BR:slal01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   111664013
Exosome [BR:slal04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   111664013
  Exosomal proteins of breast cancer cells
   111664013
SSDB
Motif
Pfam: AMP-binding AMP-binding_C
Other DBs
NCBI-GeneID: 111664013
NCBI-ProteinID: XP_023274213
LinkDB
Position
Unknown
AA seq 697 aa
MQAQEVLRQLRIPELDDVRQYVRGLPTNALMGMGAFAAITTYWFASRPKALKPPCDLGQQ
SVEIPGGERARRSVLNDNDINMTHYYNDALTMYEVFQRGLRVSNNGPCLGSRKPNQPYEW
QSYREVADRAEHVGSALLHRGHSHTGDKFIGIFSQNRPEWTISELACYTYSLVAVPLYDT
LGTEAIAYIIEKAAISTVICDVPEKARMILDCVSGKGRTVKTIVLMEAFDSDLVTRGQEC
GIEILSLKDFEALGKANHQTPVPPKPEDLALICFTSGTTGNPKGAMLTHGNVISNTAAFI
KVTQGSLKPSTKDVLISFLPLAHMFERVVEGVILIHGARIGYFQGDIRLLMDDLKTLQPT
VFPVVPRLLNRMFDKVFGQANTPLKRWLLDFAFRRKEAELKNGVVRRDSMWDKLIFKKVQ
ASLGGRVRLMITGAAPVSPTILTFLRAALGCQFYEGYGQTECTAGCSMSMPGDWTAGHVG
PPLPCNTLKVVDVAEMNYLAANGEGEVCVKGPNVFQGYLKDPEKTAEAIDKDGWLHTGDI
GKWLPNGSLKIIDRKKHIFKLAQGEYIAPEKIETVYNRSDPVAQIFVHGDSLQACLVAIV
VTDPDFLPIWAKKKGIEGSYSELSSSKEVKNAILEDILRLGKEAGLKSFEQVRDIALHTE
MFSVQNGLLTPTLKAKRAELRSHFREQIDELYAKIKI
NT seq 2094 nt   +upstreamnt  +downstreamnt
atgcaggctcaggaagtcctgagacagctgcgcattcccgagctggatgacgttcggcag
tacgtgcgcggcttgcccaccaacgcgctcatgggtatgggtgctttcgctgccatcacc
acctactggtttgcctcccggccaaaagccctcaaaccgccctgtgacctcggacagcag
tcagtggaaataccaggtggagaacgtgcacgaagatcagtgctcaacgataatgacata
aacatgacgcactactacaacgatgcactcacaatgtacgaggtgttccagcgagggctc
agagtatcgaataatggaccttgtctaggatcaagaaaaccaaaccagccgtatgagtgg
cagtcttacagagaggtggcagacagagcagagcacgtcgggtctgccctccttcaccga
ggacactctcatacaggagacaagttcattggtattttttcccagaacaggccagagtgg
accatttcagagttggcctgttacacatactccttggtggcagtcccgctgtacgacaca
ctcggcacggaggcaatcgcctacatcatcgagaaagctgccatctcaaccgtgatctgc
gatgtgcctgaaaaggctcggatgattctggactgcgtcagcgggaaaggccgaactgtg
aagacgattgtgctcatggaggcgtttgacagcgacctggtcactcgtggacaggagtgt
ggcattgagatcctgagtttgaaggactttgaggccttgggtaaagcaaaccaccagaca
ccagtgcccccaaaaccagaggacctcgcactcatctgctttacgtccggaaccacagga
aatccaaaaggtgcaatgcttactcacggaaatgtaatctccaacactgcagctttcatt
aaagtaacacagggctcactgaagcccagtactaaagatgtgctcatctccttcctccca
ttggcccatatgtttgagagggtggtggagggagtcatcctcatccacggcgctcgaatc
ggctacttccaaggagacattcgacttttaatggatgatttgaaaacgctgcagccaaca
gtcttccctgtggtcccacgtcttctcaaccgcatgtttgataaggtatttggtcaggcc
aatacaccgctgaagagatggctgctggattttgccttcaggaggaaggaggcagagctg
aaaaatggcgtggttagaagggacagcatgtgggacaaactcatcttcaaaaaagtacag
gccagtcttggcggtcgtgtgagactcatgattacaggagcagcaccggtgtcaccgacc
atcctgacgttcctgcgagctgctctgggctgtcagttttatgaaggctacggtcaaact
gaatgtacagctggttgctccatgtcaatgcctggagactggacagcaggtcacgtgggg
cctcctctgccctgcaacacgctcaaagtggtggatgtggcagaaatgaattacctggca
gccaatggagaaggagaggtgtgtgtcaaaggaccaaatgtattccagggatacctgaaa
gaccctgagaaaacggccgaggcaatcgacaaggatggatggctgcacacaggagacatt
gggaaatggcttcctaatggcagtctgaagatcattgacagaaagaagcacattttcaag
ctggcacagggggaatacatcgcccccgagaagatagaaaccgtctataatcgcagtgat
ccagtggcccagatatttgtacatggtgatagcttacaggcatgtctggtggcgatagtg
gtgactgatccagactttttacctatttgggccaagaaaaaagggatcgaaggatcctac
tctgaactgtccagtagcaaggaggtgaagaacgctatcctggaggacatcctgaggctg
ggcaaagaagcaggactcaagtcttttgaacaggtgagagacattgcgttacacaccgag
atgttttctgtccagaacggtctcctgacacccaccctgaaggccaagagggctgagctt
cggagccacttcagagagcagattgatgaactttatgccaaaattaagatctaa

KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111664226
Entry
111664226         CDS       T06058                                 

Definition
(RefSeq) long-chain-fatty-acid--CoA ligase ACSBG1-like
  KO
K15013  long-chain-fatty-acid--CoA ligase ACSBG [EC:6.2.1.3]
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal00061  Fatty acid biosynthesis
slal00071  Fatty acid degradation
slal01100  Metabolic pathways
slal01212  Fatty acid metabolism
slal03320  PPAR signaling pathway
slal04920  Adipocytokine signaling pathway
Module
slal_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:slal00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    111664226
   00071 Fatty acid degradation
    111664226
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    111664226
   03320 PPAR signaling pathway
    111664226
Enzymes [BR:slal01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     111664226
Lipid biosynthesis proteins [BR:slal01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   111664226
SSDB
Motif
Pfam: AMP-binding
Other DBs
NCBI-GeneID: 111664226
NCBI-ProteinID: XP_023274502
LinkDB
Position
Unknown
AA seq 391 aa
LSHIAAQIYDLWTGIQWGELVYFAQPDALKGSLITTLREVNPTSHMGVPRVWEKMMEKIK
QGISQCGYVKKKLVTWAMSVSLEANQKEDEKPFLLSLTDSLVLQKLRTELGLSCCQKFFS
GAAPISSETVQFFLGLNIRLFEAYGMSESTGPHFMSGPKVYKLPSCGKVVPGCRYKVANI
DSDGTGEICFWGRNIFMGFLNMEDKTREALDEDGWLHSGDLGKIDEEGFLYITGRIKELI
ITAGGENIPPVPIEEAVKKELPIISNAMLIGDKRKFLSMLLTLKCCTNAETMEPTEELSL
EAVEFCQLQRSQATKVSDISGGKDKEVYRAIQEGIERVNSAATSNAQRIQKWTILMKDFS
VSGGELGPTMKLRRPVVLEMYHKVIEGLYQE
NT seq 1176 nt   +upstreamnt  +downstreamnt
ctcagccacattgcggctcagatctatgatctctggacaggcatccagtggggtgagctg
gtatactttgcacagccagatgccttaaagggaagcctgataacaacactgcgagaagtt
aatcctacatcccacatgggtgtccctcgagtgtgggaaaaaatgatggagaagattaaa
cagggaattagtcagtgtggatatgtgaagaagaaactggtgacatgggcaatgtcagtc
agcctggaggccaatcaaaaggaagatgagaaaccattcctgctgtccctgactgacagt
ctcgtgctgcagaagcttcggactgagctgggcctgtcttgctgtcagaagttcttctct
ggagcagcaccaattagtagtgaaactgtgcagtttttcctggggctgaacatccgcttg
tttgaggcttacggtatgagtgagagcacaggacctcatttcatgtcaggtcccaaagtt
tacaaattaccaagttgtggtaaggtggtgcctggctgtcgatacaaagtggccaacata
gactctgatgggacgggtgaaatttgcttttggggacgcaacattttcatgggtttcctc
aacatggaagacaaaacaagagaagctttggatgaagatggatggctgcattcgggagac
ctggggaagatagatgaagagggtttcttgtacatcacagggagaattaaagagttgatt
atcacagctggaggagagaacattccccctgttcccatagaggaagcagtgaagaaggag
ctaccgatcatcagcaacgccatgctgataggtgacaagagaaagttcttgtccatgctt
ttaaccctgaagtgttgtaccaatgcagaaacaatggaaccaacagaggagctgagtctg
gaggctgtggagttttgccagctgcaacgaagccaagcaaccaaggtgtctgacatcagt
ggaggaaaagacaaagaagtgtaccgggccattcaagagggaattgagagagtcaactct
gctgccacgtctaatgcccaacgcatacaaaagtggactattctgatgaaggacttctct
gtttctggaggagagctgggccccacaatgaaacttcgtcgccccgttgtgttggagatg
taccacaaggtcatagagggcctctatcaggaatag

KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111666975
Entry
111666975         CDS       T06058                                 

Gene name
acsbg1
Definition
(RefSeq) long-chain-fatty-acid--CoA ligase ACSBG1 isoform X1
  KO
K15013  long-chain-fatty-acid--CoA ligase ACSBG [EC:6.2.1.3]
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal00061  Fatty acid biosynthesis
slal00071  Fatty acid degradation
slal01100  Metabolic pathways
slal01212  Fatty acid metabolism
slal03320  PPAR signaling pathway
slal04920  Adipocytokine signaling pathway
Module
slal_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:slal00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    111666975 (acsbg1)
   00071 Fatty acid degradation
    111666975 (acsbg1)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    111666975 (acsbg1)
   03320 PPAR signaling pathway
    111666975 (acsbg1)
Enzymes [BR:slal01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     111666975 (acsbg1)
Lipid biosynthesis proteins [BR:slal01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   111666975 (acsbg1)
SSDB
Motif
Pfam: AMP-binding
Other DBs
NCBI-GeneID: 111666975
NCBI-ProteinID: XP_023278281
LinkDB
Position
Unknown
AA seq 691 aa
MEFLDEEKVEDQLESSVQESMENVQADSEEHATVGKKNIAEELAGASLAPTHSLWTTDAR
GSVRLRIEDGCPEEPITVHQMFKASVEKYGNMYALASKKNDRWEKITFLEYYQFCRRAAK
SFIKLGLERFHGVAILGFNSTEWFFSAVGAILAGGIMTGIYATNSPEACQYVASDSKANI
IVVENQKQLDKILQVCDRLPHLKAIVQYSGQLQQKLSNLYSWEDFMDLGLDVSEKQLDDI
ISSQRANQCCVLIYTSGTTGKPKGVMLSHDNITWTANHASRAGDMQPADTKQESLVSYLP
LSHIAAQIYDLWTGIQWGELVYFAQPDALKGSLITTLREVNPTSHMGVPRVWEKMMEKIK
QGISQCGYVKKKLVTWAMSVSLEANQKEDEKPFLLSLTDSLVLQKLRTELGLSCCQKFFS
GAAPISSETVQFFLGLNIRLFEAYGMSESTGPHFMSGPKVYKLPSCGKVVPGCRYKVANI
DSDGTGEICFWGRNIFMGFLNMEDKTREALDEDGWLHSGDLGKIDEEGFLYITGRIKELI
ITAGGENIPPVPIEEAVKKELPIISNAMLIGDKRKFLSMLLTLKCCTNAETMEPTEELSL
EAVEFCQLQRSQATKVSDISGGKDKEVYRAIQEGIERVNSAATSNAQRIQKWTILMKDFS
VSGGELGPTMKLRRPVVLEMYHKVIEGLYQE
NT seq 2076 nt   +upstreamnt  +downstreamnt
atggaatttcttgacgaagagaaagtagaggatcaacttgagagcagcgttcaggagtct
atggaaaacgtgcaggcagatagtgaagagcatgccactgtgggaaagaaaaatatagca
gaggagttagctggcgcatctcttgctccaactcattctctttggaccactgatgctaga
ggctcagtcagactgagaatagaagatggatgtccagaggaacctatcacagttcaccaa
atgttcaaagcctcagttgaaaaatacggaaacatgtatgcacttgccagcaagaaaaat
gacagatgggaaaagataactttcttagagtattatcaattctgtcggagagcagccaag
agctttataaagcttggtttagagcgattccatggagtggcaatactaggattcaattca
acagaatggttcttctctgcagttggtgccatcctggcaggagggataatgacagggatt
tatgccacaaactcaccagaagcatgtcagtatgtggctagtgactccaaagccaacatt
atcgtggttgaaaaccaaaagcaactggataaaatcctgcaggtatgcgacagactgcca
catttgaaagccatagtgcagtacagcgggcagctccagcagaagctctccaatctttac
tcttgggaggatttcatggacctgggtctggatgtttctgagaagcaactggatgacatc
atcagcagccagagagccaaccaatgctgcgtcctgatctacacttccggcaccacaggc
aagccgaaaggagtcatgctcagtcacgacaatatcacatggactgccaatcatgccagc
agggccggggacatgcagccggccgacactaaacaggagtcactagtcagctacctgcct
ctcagccacattgcggctcagatctatgatctctggacaggcatccagtggggtgagctg
gtatactttgcacagccagatgccttaaagggaagcctgataacaacactgcgagaagtt
aatcctacatcccacatgggtgtccctcgagtgtgggaaaaaatgatggagaagattaaa
cagggaattagtcagtgtggatatgtgaagaagaaactggtgacatgggcaatgtcagtc
agcctggaggccaatcaaaaggaagatgagaaaccattcctgctgtccctgactgacagt
ctcgtgctgcagaagcttcggactgagctgggcctgtcttgctgtcagaagttcttctct
ggagcagcaccaattagtagtgaaactgtgcagtttttcctggggctgaacatccgcttg
tttgaggcttacggtatgagtgagagcacaggacctcatttcatgtcaggtcccaaagtt
tacaaattaccaagttgtggtaaggtggtgcctggctgtcgatacaaagtggccaacata
gactctgatgggacgggtgaaatttgcttttggggacgcaacattttcatgggtttcctc
aacatggaagacaaaacaagagaagctttggatgaagatggatggctgcattcgggagac
ctggggaagatagatgaagagggtttcttgtacatcacagggagaattaaagagttgatt
atcacagctggaggagagaacattccccctgttcccatagaggaagcagtgaagaaggag
ctaccgatcatcagcaacgccatgctgataggtgacaagagaaagttcttgtccatgctt
ttaaccctgaagtgttgtaccaatgcagaaacaatggaaccaacagaggagctgagtctg
gaggctgtggagttttgccagctgcaacgaagccaagcaaccaaggtgtctgacatcagt
ggaggaaaagacaaagaagtgtaccgggccattcaagagggaattgagagagtcaactct
gctgccacgtctaatgcccaacgcatacaaaagtggactattctgatgaaggacttctct
gtttctggaggagagctgggccccacaatgaaacttcgtcgccccgttgtgttggagatg
taccacaaggtcatagagggcctctatcaggaatag

KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111667608
Entry
111667608         CDS       T06058                                 

Definition
(RefSeq) long-chain-fatty-acid--CoA ligase 1-like isoform X1
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal00061  Fatty acid biosynthesis
slal00071  Fatty acid degradation
slal01100  Metabolic pathways
slal01212  Fatty acid metabolism
slal03320  PPAR signaling pathway
slal04146  Peroxisome
slal04216  Ferroptosis
slal04920  Adipocytokine signaling pathway
Module
slal_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:slal00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    111667608
   00071 Fatty acid degradation
    111667608
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    111667608
  09143 Cell growth and death
   04216 Ferroptosis
    111667608
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    111667608
   03320 PPAR signaling pathway
    111667608
Enzymes [BR:slal01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     111667608
Lipid biosynthesis proteins [BR:slal01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   111667608
Exosome [BR:slal04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   111667608
  Exosomal proteins of breast cancer cells
   111667608
SSDB
Motif
Pfam: AMP-binding AMP-binding_C
Other DBs
NCBI-GeneID: 111667608
NCBI-ProteinID: XP_023279127
LinkDB
Position
Unknown
AA seq 698 aa
MLSQEFFQKLKVPDLDDVSQYIRGASTPMLVSMGAVAVAATYYLATRPKALPLVCDLGLQ
SVEVLGGDLARRSVLQKEDGHMTHLYDDGRTMYEFFLRGARVSNNGPCLGSRKPKQPYEW
MSYKEVMERTENLGSAFLHKGHSKTTDPYIGIFSQNRPEWTISELACYTYSLVSVPLYDT
LGTEAIAYIIDKACMSTIICDVVEKVNLVLDCVQDRKHSVKTIVLMETPDADLVNRGQLA
GIHILSLQEMEAIGKANHQQPVPPQPEDMAVICFTSGTTGNPKGAMLTHGNIVSNCSAFI
KMTEFSCPFSPSDVHISFLPLAHMFERVVQGVMIVHGARIGFFQGDIRRLTDDLNTLKPT
VFPVVPRLLNRMYDKIFGQANTSVKRWVLGFAYRRKEAEILKGIVRRDSIWDRLIFRKVQ
ASLGGRVRLMITGAAPISPTVLTFLRAAIGCQFYEGYGQTECTAGCTMTVPGDWTAGHVG
APLPCNFVKLVDVPEMNYLAVNGEGEVCVKGSNVFKGYLKDPEKTAEAIDADGWVHTGDV
GKWLPNGTLKIVDRKKHIFKLAQGEYIAPEKIENVYIRSDAVAQVFVHGDSLQACLVAVV
VPDPDFLSGWTKRTLGLDGSYEELSGRAEVKAAILEDMLQLGKKGGLKSFEQVKAIFIHT
ELFSIENGLLTPTMKAKRNEMRQHFKPQIEELYAGIKM
NT seq 2097 nt   +upstreamnt  +downstreamnt
atgctgagccaggagttctttcagaagctgaaggtgccagatctggatgatgttagtcag
tacatcaggggtgcctctacccccatgttagttagcatgggggcagtggccgtcgcggca
acctactacctggcaacacgacccaaggccctcccattagtctgtgacctcggcctgcag
tcagttgaggttctgggcggagatttggcgcgcagatcagttcttcaaaaagaagatggt
cacatgacacatttatatgatgacggcaggacgatgtacgagttcttcctcagaggagcc
cgagtttccaataatggaccttgtctgggctccaggaaaccaaaacagccctatgaatgg
atgtcttacaaagaggtaatggagcgaacagagaatctgggttcagcatttcttcacaaa
ggacactccaagaccaccgacccctacattggcatcttctctcagaacagaccggagtgg
accatcagtgagctggcatgttacacctactctctggtgtcagtccctctgtacgacaca
ctgggaacagaagccatcgcctacattatagacaaagcttgcatgtccactataatctgt
gacgtggtagagaaagtcaacctggtgctggactgtgtccaggacaggaaacactccgtg
aaaaccattgttctcatggagacccccgatgctgacctggtcaacaggggccaactggct
ggaatccacatcctcagcctgcaggagatggaggctattggaaaggccaaccatcaacaa
ccagtgcctccgcagcctgaggacatggcagtcatctgcttcaccagtggaacaacagga
aatccaaagggggctatgttgacacatgggaatattgtgtccaactgttcagccttcatc
aagatgacagagttttcctgtccctttagtcccagtgatgtccatatttccttcctgccc
ttggctcatatgtttgagagagtagtacagggagtgatgatagtgcatggggccaggatt
ggcttcttccagggagatattcgtcggctgacagatgacctgaacacactgaaacctact
gtgttccctgtggtgccccgactcctgaatagaatgtatgataagatctttgggcaggcc
aatacctctgtgaagcgctgggtgctgggatttgcctacaggaggaaggaggcagagatt
ttgaaaggcatcgtgaggagagacagtatctgggatcgacttatcttcaggaaggttcag
gccagcctcggaggtcgcgttcgtctcatgataacaggagctgctcccatctctcccact
gttctcactttcctcagagctgcaattggctgtcagttctatgaaggctatggacaaaca
gagtgtactgctggctgcacaatgaccgtgcccggggactggactgcaggtcatgttggt
gctcctctgccctgtaactttgttaaactggtggatgttcctgagatgaactacctggct
gtgaacggagagggagaggtgtgtgtgaagggtagtaacgtgttcaagggctatctgaag
gacccagagaagacagcagaggctattgatgcagatggatgggtgcacaccggagacgtt
ggaaaatggcttccgaatggcacgctgaagatcgtggacaggaagaagcacatctttaag
ctggcacagggggagtacattgcccctgagaagatagagaacgtctacataaggagtgat
gcagtagcacaagtctttgtgcacggagacagcctgcaggcatgtctggtcgcagtagtg
gtccctgaccctgacttcctgtctggttggaccaagaggaccttggggctggatggcagc
tatgaagaactgtctggcagagcggaagtcaaagcagctatcttggaggacatgctgcag
ttgggcaagaaaggaggcctcaagtcctttgagcaggtgaaggctatcttcatccacacc
gagttgttctcaatcgagaacggcctgctcactccaacaatgaaggccaagaggaacgaa
atgcgacagcacttcaaaccccagatagaagagctgtatgctgggatcaaaatgtag

KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111671267
Entry
111671267         CDS       T06058                                 

Gene name
acsl3
Definition
(RefSeq) long-chain-fatty-acid--CoA ligase 3
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal00061  Fatty acid biosynthesis
slal00071  Fatty acid degradation
slal01100  Metabolic pathways
slal01212  Fatty acid metabolism
slal03320  PPAR signaling pathway
slal04146  Peroxisome
slal04216  Ferroptosis
slal04920  Adipocytokine signaling pathway
Module
slal_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:slal00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    111671267 (acsl3)
   00071 Fatty acid degradation
    111671267 (acsl3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    111671267 (acsl3)
  09143 Cell growth and death
   04216 Ferroptosis
    111671267 (acsl3)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    111671267 (acsl3)
   03320 PPAR signaling pathway
    111671267 (acsl3)
Enzymes [BR:slal01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     111671267 (acsl3)
Lipid biosynthesis proteins [BR:slal01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   111671267 (acsl3)
Exosome [BR:slal04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   111671267 (acsl3)
  Exosomal proteins of breast cancer cells
   111671267 (acsl3)
SSDB
Motif
Pfam: AMP-binding AMP-binding_C
Other DBs
NCBI-GeneID: 111671267
NCBI-ProteinID: XP_023284123
LinkDB
Position
Unknown
AA seq 719 aa
MKLKEDLNPLLLLLFHVVVWIYTCVTFLPYHLFSWVSVPVGGVCGSEEERAKRAKARSVL
GCPEGPYRAVSAIKRLVTSLRPGVDTLDKMFEYAATKFPERDCLGTREVISEEDEQQSNG
KVFKKVVLGEYCWRSYDEVLTAASQLGSGLASLGQQPKHNIAIFCETRAEWIIAAQACFM
YNFPLATLYSTLGGPAIAHGLNETQVTHIFTSRELLETRLKAILIEVPRLQHIIVVDDTP
TSWPGYPRGISVHNMAAVQKLGARPENAARERKQPLPSDIAVIMYTSGSTGIPKGVMISH
SNIIAGITGMAERIPNLCEEDTYIGYLPLAHVLELSAELVCISHGCRIGYSSPQTLADQS
TKIKKGSKGDTSVLQPTLMAAVPEIMDRIYKNVMTKVEEMNCVQRALFTLAYNYKLEQFT
KGYSTPLCDKLVFRKVRSLLGGRTRVLLSGGAPLSAATQRFMNVCFCCPVGQGYGLTETC
GAGTISELWDYSTGRVGGPLVCSEIKLKDWVEGGYRSTDKPHPRGEILVGGPNVTMGYYK
IEAKNQEDFFVDENGQRWFCTGDIGEFHEDGCLKIIDRKKDLVKLQAGEYVSLGKVEAML
KNCSLVDNICAYANSDETYVIGFVVPNQKQLLTLADQYSIRGSWEELCNSKAIEELALKV
ITEAALAAQLERFEIPRKIRLSPDPWTPETGLVTDAFKLKRKELKTHYQDDIERMYGGK
NT seq 2160 nt   +upstreamnt  +downstreamnt
atgaagctgaaggaggacctgaaccccttgctgctgctcctcttccacgtcgtggtgtgg
atctacacctgcgtcaccttcctgccttaccacctcttcagctgggtgtcggtgcccgtc
gggggcgtctgcggctcagaggaggagcgagccaagagggcgaaggcccgctctgtgctg
ggatgtcctgaggggccctacagagcggtgagtgccatcaagaggctggtgacgtcgctg
cgcccgggagtggacaccctggataagatgtttgaatacgcggccacgaagttcccggaa
agagactgtctcggcacgagggaggtgatcagtgaggaggacgagcagcagagcaatggg
aaggtgtttaagaaggtagttctgggtgagtactgctggcgctcctatgacgaggtcctc
acagcggcgtcccagctgggcagtggtctggcatcgctgggtcagcagccgaaacacaac
atcgccatcttctgcgagacgcgagccgagtggatcatagctgcccaggcctgcttcatg
tacaacttcccattggccaccctttactccacactgggaggtccagccatcgctcatggg
ctgaatgaaactcaggtcacccacatcttcaccagcagagaactcctggagaccagactc
aaggctatcctaattgaagttccaaggctgcagcatatcattgtagtggatgacacaccg
acctcatggcccggctatccgcgtggcatcagtgtccacaacatggctgctgttcagaaa
ctgggggccaggcctgagaatgccgcacgtgagcgtaagcagccgctgccttcagacatt
gcagtcatcatgtacaccagcggatccacgggcataccaaagggcgtcatgatctcccat
agcaacatcatcgccggcatcacagggatggctgagcggatacctaatctgtgtgaggag
gacacctacatcggctacctgcctctcgcccatgtgctggagctcagtgcagagctcgta
tgtatttcccacggctgtaggatcggctactcctcacctcagactcttgctgaccagtca
accaagatcaagaaaggaagcaagggagacaccagcgtcctgcagcccaccctgatggca
gctgttccggagatcatggatcgcatctataaaaacgtgatgaccaaagtcgaggagatg
aactgcgtccagcgagctctcttcactctggcttacaactacaagctggagcagttcacc
aaaggatacagcacacctctatgtgacaagctggtgttcaggaaagttcgctctctgctg
ggaggtcggacgcgagtcttgttgtcgggaggagcgccgctctccgcagccacacagcgc
ttcatgaacgtgtgtttctgctgcccggtgggtcagggatatggcctgacggagacgtgc
ggagcgggaaccatcagcgagctgtgggattacagcactgggagagtgggagggccgctg
gtttgcagtgagataaagctcaaagactgggtggagggcggttaccgtagcacagacaag
ccacatcctcgaggagagattctggttggtggaccgaacgtaaccatgggatactacaag
atcgaggctaaaaaccaagaagacttctttgtggatgagaacggccagaggtggttctgc
acgggagacatcggagagtttcatgaagatgggtgcctaaagataattgatcgtaaaaaa
gacttggtgaagctgcaggcgggagagtacgtttccctgggaaaggtggaggccatgtta
aagaactgctcactggtcgacaacatctgcgcctacgccaacagtgatgagacatacgtg
attggctttgtggtgcccaatcagaagcagctgctcactctggcggaccagtacagcatc
cgaggctcatgggaggagctgtgcaacagcaaggccattgaggagctggccctcaaggtg
atcactgaggctgcattggcagcccagctagagcgctttgagattcctcgcaagatccgt
ctgagcccggacccctggacccctgagacaggattagtgactgatgcattcaagctcaag
cgcaaggagctgaaaacacattaccaggatgacattgagagaatgtacggtggaaaataa

DBGET integrated database retrieval system