KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111645657
Entry
111645657         CDS       T06058                                 

Definition
(RefSeq) tumor necrosis factor-like
  KO
K03156  tumor necrosis factor superfamily, member 2
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal04010  MAPK signaling pathway
slal04060  Cytokine-cytokine receptor interaction
slal04150  mTOR signaling pathway
slal04210  Apoptosis
slal04217  Necroptosis
slal04350  TGF-beta signaling pathway
slal04620  Toll-like receptor signaling pathway
slal04621  NOD-like receptor signaling pathway
slal04622  RIG-I-like receptor signaling pathway
slal04625  C-type lectin receptor signaling pathway
slal04920  Adipocytokine signaling pathway
slal05132  Salmonella infection
slal05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:slal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111645657
   04350 TGF-beta signaling pathway
    111645657
   04150 mTOR signaling pathway
    111645657
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111645657
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    111645657
   04217 Necroptosis
    111645657
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111645657
   04621 NOD-like receptor signaling pathway
    111645657
   04622 RIG-I-like receptor signaling pathway
    111645657
   04625 C-type lectin receptor signaling pathway
    111645657
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    111645657
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111645657
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    111645657
Cytokines and growth factors [BR:slal04052]
 Cytokines
  Tumor necrosis fators
   111645657
Glycosaminoglycan binding proteins [BR:slal00536]
 Heparan sulfate / Heparin
  Cytokines
   111645657
SSDB
Motif
Pfam: TNF
Other DBs
NCBI-GeneID: 111645657
NCBI-ProteinID: XP_023250710
LinkDB
Position
Unknown
AA seq 244 aa
MEGECKVQLDAAVSTEARKHTTQGVRPGSKLTTALLAFTLCLAFAAAAVLFFNTHTKEQT
RQDENDNDIHLALRQISNGRPAIHLEGKHNENLSTSVEWKNNVDQSHATGGLKLENNEIV
IPRTGLYFVYSQASFRVSCTSSDADDATSKPMVHLSHTVKRWSSSYGGDNTENSYQTILH
SLRTACQKTASSDGDEEGNWYTAVYMGAVFNLRKGDRLKTMMEERMLLKLEDEPGKTFFG
VFAL
NT seq 735 nt   +upstreamnt  +downstreamnt
atggaaggtgaatgcaaagtgcagctggatgccgctgtctccacagaggccaggaaacac
acgacgcagggtgtcagacccggctcaaagctaaccacggccctgctggcgttcacgctc
tgcctcgccttcgccgccgctgccgtcctcttctttaacacacataccaaggagcagaca
agacaagacgaaaacgacaacgacattcatctcgccttgaggcaaatttccaatggaaga
ccggccattcatttagaaggtaaacacaacgagaatctgagcacttcagtggagtggaag
aataacgtggaccagtcccatgctacaggtggactgaagctggagaacaacgagattgtg
atccctcgaaccggcctgtactttgtttacagccaagcgtccttccgggtcagttgcaca
agcagtgacgccgatgacgccacctcaaagcccatggtccacctgagccacactgtgaag
cgctggtccagctcgtacggaggcgacaacacagagaactcctaccagaccatccttcat
tctctccgcaccgcctgccagaagacggccagcagcgacggggacgaggagggaaactgg
tacaccgccgtgtacatgggggctgtgttcaacctgaggaaaggggacaggctgaagacg
atgatggaggagaggatgctgctgaagctggaggatgagccagggaagacgttcttcggt
gtatttgccttgtga

KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111655660
Entry
111655660         CDS       T06058                                 

Definition
(RefSeq) tumor necrosis factor-like isoform X1
  KO
K03156  tumor necrosis factor superfamily, member 2
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal04010  MAPK signaling pathway
slal04060  Cytokine-cytokine receptor interaction
slal04150  mTOR signaling pathway
slal04210  Apoptosis
slal04217  Necroptosis
slal04350  TGF-beta signaling pathway
slal04620  Toll-like receptor signaling pathway
slal04621  NOD-like receptor signaling pathway
slal04622  RIG-I-like receptor signaling pathway
slal04625  C-type lectin receptor signaling pathway
slal04920  Adipocytokine signaling pathway
slal05132  Salmonella infection
slal05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:slal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111655660
   04350 TGF-beta signaling pathway
    111655660
   04150 mTOR signaling pathway
    111655660
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111655660
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    111655660
   04217 Necroptosis
    111655660
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111655660
   04621 NOD-like receptor signaling pathway
    111655660
   04622 RIG-I-like receptor signaling pathway
    111655660
   04625 C-type lectin receptor signaling pathway
    111655660
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    111655660
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111655660
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    111655660
Cytokines and growth factors [BR:slal04052]
 Cytokines
  Tumor necrosis fators
   111655660
Glycosaminoglycan binding proteins [BR:slal00536]
 Heparan sulfate / Heparin
  Cytokines
   111655660
SSDB
Motif
Pfam: TNF T4SS_pilin FixS
Other DBs
NCBI-GeneID: 111655660
NCBI-ProteinID: XP_023262904
LinkDB
Position
Unknown
AA seq 254 aa
MVDYTTAPSHVELALEDRTVILVEKKSSTEWIWKVLGALLIVALCLGGVLLFAWHWNGPE
MMIQSGQTEALIETDSGEKTDPHYTLKRISSKAKAAIHLEGSYDDEDKSSKAALEWKNGQ
GQAFAQGGFLLADNQIVIPRTGLYFVYSQASFRVSCSDGEEDEAGKRFMPLSHRIWRYSD
SLGGKASLMSAVRSACQTTAQEEDSYRDGRNWYNAIYLGAVFQLNKGDKLWTETNQLSEL
DTDEGKTFFGVFAL
NT seq 765 nt   +upstreamnt  +downstreamnt
atggtggactacacaaccgcaccgagccacgtggagttggcactcgaggacaggacggtg
attttggtagaaaagaagtcatctacagagtggatatggaaggtgttgggggctcttctc
attgtggccctttgtttgggaggtgtcctgctgtttgcttggcactggaatgggccagaa
atgatgatacagtcaggacaaacagaagcactaatcgagacggactctggtgagaaaaca
gatccccactacacgctgaagcgaatcagcagcaaagccaaggcagccatccatttagaa
ggtagctacgatgacgaggacaagagctcgaaagcggcgctggagtggaagaacggtcag
ggccaggcgttcgctcagggcggcttcctgctggccgacaaccagatcgtcatcccgcga
accggcctctacttcgtctacagccaggcgtcgttcagagtctcctgcagcgatggcgag
gaggacgaggcgggaaaacgcttcatgcctctcagccacaggatctggcggtactcagac
tccttgggcggcaaagcgtctctgatgagcgcggtgaggtcggcgtgccaaaccaccgcc
caggaggaggacagttacagggacggacggaactggtacaacgccatttatctgggtgca
gtgtttcagctgaataaaggagacaaactgtggacggaaaccaaccagctatcagagctg
gacaccgacgagggcaagactttctttggtgtgtttgcactttaa

DBGET integrated database retrieval system