KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111646010
Entry
111646010         CDS       T06058                                 

Definition
(RefSeq) insulin receptor substrate 2-like
  KO
K07187  insulin receptor substrate 2
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal04068  FoxO signaling pathway
slal04140  Autophagy - animal
slal04910  Insulin signaling pathway
slal04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:slal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    111646010
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    111646010
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    111646010
   04920 Adipocytokine signaling pathway
    111646010
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:slal04990]
    111646010
Domain-containing proteins not elsewhere classified [BR:slal04990]
 Phosphotyrosine binding (PTB) domain-containing proteins
  IRS related family proteins
   111646010
SSDB
Motif
Pfam: IRS PH PH_11 Mcp5_PH PH_8
Other DBs
NCBI-GeneID: 111646010
NCBI-ProteinID: XP_023251142
LinkDB
Position
Unknown
AA seq 1039 aa
MASPPATGGHLLSNGTNGVKKCGYLRKQKHGHRRFFVLREPTERCPARLEYYESEKKWRN
KSAAKRVITLDSCLCVNKRADAKHKHLIALYTKDEYFAVAADNEQEQESWFTVLTDLIAE
GKVYDSPASTSSLVGFEEASYGLITPAAAAYKEVWQVNLKSKGLGQIKNLTGVYRLCLSS
RTISFVKLNSETAAVSLQLMNIRRCGHSDSFFFIEVGRSAVTGPGEFWMQAEDSVVAQNI
HETILEAMKAMKELSEFRPRSKSQSASTNPISVPTRRNLNNLPPSQTGLVRRSRTDSMAA
TSPGRKFTSCRIRTASEGDGSVTRPVSMSISVNGSPTSPSCGNHLSRSHTLSSGRTCRML
ESSSNLHHSRSMPVSNSPPAASSPISMSPRGGAGIATPDKARRPFSCSASISGSLSDTGF
MLCDDYSSSPGEPKFLPLTRSDTPDSLSSTPPSRDISDPCGYMIMESANGGRVLAGGDLA
FDKAYRKRTHSLTTPRQQRVVAPLSSASLDEYTLMRMAHGQNSHSASPKVCYPEDYGDIE
IGSSRSSSSNLGDDGYMPMTPGVASQSGKGDNYVPMSPMCVSAPKQIVNPRVHPQAGAGG
GGGYKTNSPCSSSLEDNGYMRMWCGSKSSMESPDRHGEYMNMSPGNPPPLQTPPDYYLGL
LAGEPAPVRSAYQGGSLTLPAKLQASKNEDGCQYVLMSPQSMRQRAGESDYYSVMQPSTS
PLSPSVPSPVRHGRVENLAYRGRLGRPNRLSLDTLRTLPSMNEHPLPGEPRSPGEYINID
FSCISSIVSTESQSSSLGSSGGGGPGRSSLTDYINLELASHSSKEVNTPAERLGPLPVLS
MCPCSEEGLEMKNDYTEMSFGMTSSPPQLVPQNTASSQRRLSLEDQGVPESIGVFLLGAT
SSPTVDPDCSAKVIRANPQGRRRHSSETFSSTATVTPVFPSFARGDAVKRHSSVENISSR
SSEGSDEEYGSPVNRQSSAGYPNGLNYIALNLLDNRDVEKCEDLVGFKPTSSCKGGINGL
HSTPYVCLGFKEAATTAKD
NT seq 3120 nt   +upstreamnt  +downstreamnt
atggcaagtcctccggcgacgggaggacacctgttatctaatgggacgaacggtgtgaag
aagtgcgggtacctgaggaagcagaaacacggacacaggcgcttcttcgtgctgcgggag
ccgacggagcgatgccctgcccggctggagtattatgagagcgagaagaaatggaggaac
aagtccgccgccaaacgggtgataactttggactcgtgtctgtgcgtaaacaaacgggcc
gacgccaaacacaagcacctcatcgccctctacaccaaggacgagtacttcgcggtggct
gcggacaacgagcaggagcaggagagctggttcacggttttgactgatttaatagccgag
gggaaagtgtacgacagccccgcatccacctcctctttagtgggctttgaggaggccagc
tacggactcattacccccgcagcagctgcctacaaggaggtatggcaggtcaacttgaaa
tccaaaggcttgggtcagatcaagaacctcactggggtgtacaggctgtgtctgtccagc
cgcaccatcagctttgtgaaactgaactctgagacagcagctgtcagtctacagctcatg
aacatccgcaggtgtggacactcggacagcttcttcttcatagaggtgggccggtcggcg
gtgaccgggcccggggagttctggatgcaggcggaggactcggtggtggcgcagaacatc
cacgagaccatcctggaggccatgaaggccatgaaggagctgtcagagttcaggccgcgg
agcaagagccagtctgccagcactaaccccatctctgtgcccacgcgacgcaacctcaac
aacctcccccccagccagacgggcctggtgaggagatccaggacagacagcatggccgcc
acgtcccctgggaggaagttcacgtcctgccggattagaaccgccagcgagggcgatggc
agcgtgacccggcccgtgtccatgtccatatctgtgaatgggagtcccaccagccccagc
tgtggcaatcacctcagcaggtctcacaccctcagcagcgggcgcacctgcaggatgctg
gagtcctcctccaacctgcaccacagcaggtccatgccggtgtccaactcccctccagcc
gcctccagccccatcagcatgtctcccagaggcggggctggtatcgccactccggacaaa
gccaggcggcctttcagctgcagcgcctccatctccggctccctcagcgacaccggcttc
atgctgtgtgacgactacagctccagcccaggtgaacccaaattcctccccctgacccgc
agcgacacccctgactccctgtccagcacgcctccgtcccgggacatcagcgacccctgt
ggctacatgataatggagagcgcgaacggcggcagggttctggctggtggcgatctggcg
tttgacaaggcttacaggaagcgcacgcactccctcaccacgccgcgtcaacagagggtg
gtggcgccgctgtcctccgcctccctggatgagtacacgctcatgaggatggcgcacggg
cagaactctcactccgcctcgcccaaggtgtgctaccccgaggattacggagacatcgaa
atcggttcctccaggagctccagcagtaaccttggcgacgatggctacatgccaatgacg
ccaggtgtagcatcccagtctggaaagggagacaactacgtgcccatgagccccatgtgc
gtctcggcacccaagcagattgtgaaccccagggtgcaccctcaggcgggggccggcggc
ggcggcggctacaaaaccaactccccctgcagcagctctctggaggacaacggctacatg
agaatgtggtgtggctccaaatcctccatggagagcccggacagacatggcgaatacatg
aacatgtcacccggaaacccacctccactccagactccccctgactactacttgggcctg
ctggccggtgaacctgcgccggtgaggtcggcttaccagggcggctccctcacgctgcct
gccaagctccaggcgtcaaagaacgaagatggctgccagtatgtgttgatgagccctcag
agcatgaggcagagggccggggagtccgactattattcggtgatgcagcccagcacctct
ccgctgagcccctcggtcccttctcccgtcagacacggccgggtggagaacctggcctac
agggggaggctgggccggcccaacaggctttccctggacaccctgaggaccctgcccagc
atgaatgaacaccccctgcccggagagccgcggagccccggggagtacattaacattgac
ttcagctgcatcagctccatcgtatccacagagagccagtcttcatctctgggctccagc
ggcggcggcggcccggggaggtcctccctgactgactacatcaacctggagctggcgtca
cactcctccaaggaggtgaacactcctgctgagcgcctgggccccctccccgtgttgtcc
atgtgcccctgctctgaggagggcctcgagatgaaaaatgactacaccgagatgtcgttc
gggatgaccagctcgccgccgcagcttgttcctcagaacacagccagcagccagaggagg
ctctctctggaggaccagggagtcccagaaagcattggggtcttcctgcttggggccacc
tcttcccccacagtggaccccgactgctccgccaaggtgatccgggccaatccacaggga
cgccggcgccacagctccgagaccttctcctccaccgccaccgtgacgccggtctttccc
tccttcgcccggggcgacgcggtgaagaggcacagctccgtggagaacatctcgtcccgg
agcagcgagggctccgacgaggagtacggcagcccggtgaaccggcagagctcggccggc
taccccaacggactgaactacatcgccttgaacctgctggacaacagggacgtggagaag
tgcgaagacctggttggcttcaaacccaccagcagctgcaaagggggtatcaatggatta
cacagcacgccatatgtctgtttgggattcaaagaggctgccaccactgccaaagactga

KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111662143
Entry
111662143         CDS       T06058                                 

Gene name
irs2
Definition
(RefSeq) insulin receptor substrate 2
  KO
K07187  insulin receptor substrate 2
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal04068  FoxO signaling pathway
slal04140  Autophagy - animal
slal04910  Insulin signaling pathway
slal04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:slal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    111662143 (irs2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    111662143 (irs2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    111662143 (irs2)
   04920 Adipocytokine signaling pathway
    111662143 (irs2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:slal04990]
    111662143 (irs2)
Domain-containing proteins not elsewhere classified [BR:slal04990]
 Phosphotyrosine binding (PTB) domain-containing proteins
  IRS related family proteins
   111662143 (irs2)
SSDB
Motif
Pfam: IRS PH PH_11 Mcp5_PH
Other DBs
NCBI-GeneID: 111662143
NCBI-ProteinID: XP_023271675
LinkDB
Position
Unknown
AA seq 1121 aa
MASPPNTGDQSLIPSNTNASNAVKKCGYLKKQKHGHKRFFVLKEPSEGFPARLEYYESEK
KWKNKSAAKRVIPLDCCLNINKRADAKHKYLIALYTKDEYFAVAAENEQEQESWYRVLTD
LMAEGKVYDGSASNSASSLVGFDEASYGVITPVTAVYKEVWQVNLKSKGLGQSRNLTGVY
RLCLSSRTISFVKLNSEVASVILQLMNIRRCGHSDSFFFIEVGRSAATGPGELWMQADDS
VVAQNIHETILEAMKAMKELSEFRPRSKSQSSGTNPISVPTRRHLNNLPPSQTGLPRRSR
TDSMAATSPVSKFSSCRIRTASEGDGTMTRPMSVTGSPLSPGVHRTLLSRSHTITARPCR
TFESSSLQHSKSMSMPLSPSPPMATPSLVSLSSCPDSSAPRPSSCSASFSGSPSDAGFIS
CEEYGSSPADARDLRLPLTLRSNTPESLKADTPPSRDSSELEGYMVMERQNQNGYRRLPD
LDKAYRKRTYSLTTPRQQRPPPQVSSASLDEYTLMRATYTSGSQSSRRCHTASPKGTYPE
DYRDVQIGSNSVQADSGYMPMMPGVTPQTPGSKDDPYMPMSPMCVSAPKQIINPHSHSSS
AGLAPRTDSPGSVSLEESGYMRMWCGTKMSVESTDGKLTNGEYLNMSPVDPLVSLTPPDY
ILSPSGGDPHPQQHHRQPYFYSSLPRSLKGPLQRNGSTDTDQYVVMSLQRQRIEEESNYC
PVSPRDSVASSSPVTSSAPSPLRLARLDGGLVHRSRVCRPTRLALESLRTLPCMSEHPLP
AEPRSPGEYINIDFSSVTLDPQASTVSESSESSVSLTCGKRGSLPLSDYANVDVSSPGQL
GSTQARVSPTAGCLNHTPEVLSCPLASTQQGMQEGKEEEGEKSKEGKTEERGMVEEYPHQ
QQVSLTCQPAPVKDDYTEMTFSPLAPLPALCTTDAASPPTSPTACVQRLSLESSIVETVP
HVPEHSFLMGGPSLSVTLVDPNRGAKVIKADPQGRRRHSSETFSSTTTVTPVCPSFAHDT
KRHSSASVENVSRTVRSSEGPEEDYGNNSPMCRETSAGYQNGLNYIALNLMEGNFGGCRL
GGCDGLLRFKPACGCKGGMNGFNTSPYASLGFKETAAAVKE
NT seq 3366 nt   +upstreamnt  +downstreamnt
atggcgagtccgccaaacacgggagaccagtcgttaatacccagcaatacgaacgcgagc
aacgctgtcaagaaatgcggatacctaaagaagcagaaacacggacacaagcgctttttt
gttttgaaagagccgagcgaagggttccctgcgcggctggagtactacgagagcgagaag
aaatggaaaaacaaatcggccgcgaagagagttattcccctcgactgctgcctcaatatc
aacaagagagcggacgcaaaacacaaatatcttattgctctttataccaaggacgaatat
tttgccgtagcggcagaaaacgagcaggaacaggagagctggtaccgggttctgacggat
ttaatggcagaggggaaagtgtatgatggctcggcgtctaactcagcgtcctcgctggtt
ggcttcgacgaggcgagctacggtgtaataacgccggttaccgccgtctacaaggaggta
tggcaagttaatctgaaatctaaaggcctggggcagagcagaaatttgaccggggtgtac
agactgtgtctctccagccggactatcagcttcgtcaagttgaactccgaggtagcctcc
gtcatcttacagctgatgaatatccggaggtgcggccactctgacagcttctttttcatt
gaggtgggtcgttctgcggccacgggtcccggggagttatggatgcaggctgatgactct
gtggtggcacaaaacatccacgaaactatcttggaggcgatgaaagccatgaaggagctg
tcggaattccgtccgcgcagcaagagccagtcgtctgggacaaacccaatctctgtgccc
acacggaggcacctgaacaatctcccccccagccagaccgggcttccccggcggtcgcgc
actgacagcatggctgcgacctctcctgtgagcaaattttcttcctgtcgaatacgcacg
gcgagcgagggcgatggcaccatgacacgccccatgtcagtgactgggagcccgcttagc
ccgggggtccacaggaccctcctgagcagatctcacaccatcacagctcgcccttgtcgg
acatttgaatcctcttccctccagcacagtaagtccatgtctatgcccctgtctccctcc
ccacccatggccacccctagcctagtgagtctgtcctcctgcccagacagcagtgcccct
cgcccctccagctgcagtgcctccttctcaggctcacccagtgatgctggttttatatca
tgtgaggagtatggctctagtcctgcagatgcacgggacctcaggctgccactcaccctc
cgtagcaacactcccgagtccctcaaagctgacacccccccctcccgggacagcagtgag
cttgaaggctacatggtgatggagcgacagaaccagaatggttaccgtcggttaccggac
ctggacaaggcatatcgaaagcgcacatactccctcaccactccccgccagcaaaggccc
cctccccaagtatcttcagcctctctggatgagtacactcttatgagggcaacgtacacc
agcggaagccagtcttctcgcaggtgccacactgcctcccctaaagggacctatcctgag
gattacagggatgtccagatcggatctaacagtgtccaagctgacagtggttatatgccc
atgatgccaggtgtgacacctcagacgccagggtctaaagatgacccctacatgcccatg
agccccatgtgtgtttctgctccaaagcagatcatcaacccccattcgcactcctcttca
gcagggctggccccacgcacagactcccccgggagtgtttctctggaggagagtggctac
atgcgcatgtggtgcggaaccaagatgtcagtggagagcacagatggaaagctcaccaac
ggagagtacctgaatatgtctcctgttgaccctctagtgtctctcacaccccctgactac
atccttagtccctcaggaggagatccccacccccaacaacatcacagacagccttatttt
tatagctctctaccacgctcacttaaaggcccattgcagcgcaacgggtccacagacaca
gaccagtatgtggtgatgagtttacagagacagcggatagaagaagagtccaactattgt
cctgtctctccacgagactcggtggccagcagctctccggtgacctcctctgccccatct
cctctcagactggctcggttagatggaggtctggtacaccggagtagggtgtgtcggcct
acccgcctggctctggaatccctcagaacgttaccatgtatgagcgaacacccccttccc
gcagagccacgcagcccaggagagtacatcaacatagactttagtagtgttaccctcgac
ccacaggcatccacagtgtcggagagctctgagtcttctgtgagtttaacatgtggaaag
agaggatccctgccactctcagactatgctaatgttgatgtcagttctccaggtcaactt
ggctcaacccaagctagggtttcccccactgcagggtgcctaaaccacacacctgaagtc
ttgtcttgtcctctggccagcacccagcaaggcatgcaggaaggcaaggaggaagaaggg
gaaaaaagcaaagagggaaagacagaggagagggggatggtagaggagtatcctcaccaa
cagcaggtgagcctgacgtgtcagcctgctccagttaaggatgactacactgagatgact
ttcagtcctcttgccccgctccctgctctctgcaccactgatgctgcttccccccccacc
agccccaccgcatgtgtccagagactcagccttgaaagcagcattgtggaaacggtgccc
catgtcccagagcactcttttctcatggggggtccttcgttatctgtcactctcgtggat
ccaaacaggggagccaaagtgatcaaggcggatcctcaagggcgccgacggcacagttct
gagactttttcctccaccaccactgtcacacccgtgtgtccatcctttgcccacgacacc
aaacggcacagctccgcctctgtggagaatgtgtcccgcactgttcgcagctctgaggga
cctgaagaggactatggcaacaacagccccatgtgcagggagacgtcagctggttatcag
aatggacttaactacattgccttaaacttgatggagggaaactttggaggatgccggttg
gggggctgtgatggactcttgaggttcaagcccgcctgtggctgcaagggtggcatgaat
ggtttcaacaccagcccctatgccagcctgggattcaaggagactgctgctgctgtgaaa
gaatga

KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111665377
Entry
111665377         CDS       T06058                                 

Definition
(RefSeq) insulin receptor substrate 1-like
  KO
K07187  insulin receptor substrate 2
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal04068  FoxO signaling pathway
slal04140  Autophagy - animal
slal04910  Insulin signaling pathway
slal04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:slal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    111665377
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    111665377
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    111665377
   04920 Adipocytokine signaling pathway
    111665377
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:slal04990]
    111665377
Domain-containing proteins not elsewhere classified [BR:slal04990]
 Phosphotyrosine binding (PTB) domain-containing proteins
  IRS related family proteins
   111665377
SSDB
Motif
Pfam: IRS PH
Other DBs
NCBI-GeneID: 111665377
NCBI-ProteinID: XP_023276133
LinkDB
Position
Unknown
AA seq 567 aa
MQTSELPSSRFYEELFCTSQTTGPLVPLASALITSAGPQSDVVKQGYLGKLERNHRRYFV
LRAGSHTGPSRLEWYKNQEKFTAMEKSSGKAVLFWSSKQGRTGSSRKGHTVAVYAKDQTM
VLVVEDQQEQEDWYLAIKKLMEEEQKDEEHGEGLDEEDDDGYCTLPLAAFFKEVWPVSVK
PRGLGRSKSLTGETRLCLTATSLILVKVGTCSDLPSVTIPLLSVRRFGHLDGSFFLELGR
SAPDGPGEIWMEARDQGNQGIAQQIHEVVRETVRALRALPDFSRSPTSNHNKPQALLISK
RSRPKHRDKLINVGPRSSLLAPNTDVHTSPKCYLEPRKPDETEPESTLSLTSHLSPLRSQ
QSSVPETGSYMEMKMEHCRGATCRMESLELGEEEEEEEKALGYMMMSPQVSDSSPALPMD
DYVTMTSPCKHQGPPFSSPSPSSSLQTSFNSFTSDSYSPVHPSHHQTNEHIYTRPLDDAE
LEQKSVQDRRHLAQRVATSSPVGSVNVSDLMPPFFTSGAGYTKPVQASPNSGTGRSTRLL
AVPDQSAARRYRLSSCLLSCLQAKDGS
NT seq 1704 nt   +upstreamnt  +downstreamnt
atgcagacaagtgaacttccttcatctcgtttctacgaagaactcttctgtaccagccag
actaccggccctcttgtccctctagccagcgccctcataacctctgctgggccacagagt
gatgtggtgaaacaaggttacctggggaagctggagcgaaaccacagaagatattttgtc
ctgagagcaggaagtcacactgggccgagccgacttgagtggtacaagaaccaggagaag
ttcacagcaatggagaagtcttctggtaaagctgtgctgttctggtcgagcaagcaaggc
cggactggcagttccaggaaaggccacacggtggcggtgtatgccaaggatcagaccatg
gtgctggtggtggaggaccaacaggaacaagaagattggtatctggccattaagaaactg
atggaggaggagcagaaggatgaagagcacggagaggggcttgatgaagaagatgatgat
gggtattgcactctgccgcttgctgctttcttcaaagaggtctggcccgtctcagtgaag
cccagaggtctgggccgttccaagtccctcacaggagagacgcggctttgcctcacagct
acctcactcatcttggtcaaagtgggcacatgcagtgatttgccgtcggttacgatacct
ttgctgagtgttcggcgctttggccacttggatggctcgttcttcttggagcttggcagg
tcagcacctgacggtcctggagagatctggatggaagcaagagaccaaggaaaccaagga
attgctcagcaaattcatgaagtggttcgggagacggtacgggcactcagagctcttcct
gatttcagccggtcaccaacctccaaccacaataagcctcaagcacttctgatctcaaaa
cgcagcagacccaagcacagagacaagttgattaatgtgggaccacgtagctctctcctg
gcacccaatactgacgtccacactagtccaaagtgttacctagagccccgcaaaccagat
gaaacagagcctgaatctactctgagcctcacctcacatctcagccctttacgatcccag
cagagctccgtgcctgagactggcagctacatggaaatgaagatggagcactgcaggggt
gcaacctgcaggatggagagcttggagctgggagaggaggaggaggaggaggagaaggcg
ctggggtacatgatgatgtccccacaggtcagcgacagttcgcctgcattgcctatggat
gactatgtgaccatgacaagcccatgcaaacaccaagggcctcccttctcttcaccttca
ccttcttcttcccttcagacatcattcaacagcttcacctctgacagctactctcctgtg
cacccatcacatcatcaaaccaatgagcacatctacacccgaccactggatgatgcagag
ctggagcagaagtcagtccaggacagacgccacctggcacagagggtggccacttcttct
cctgtggggagcgttaatgtgtctgacctgatgcctccatttttcacgagtggagcaggc
tataccaagccagttcaggctagtccaaactctggtacaggccggtctactcgactccta
gctgtaccagaccagtctgctgctagaagataccggctgtcatcctgtctgctctcttgc
ctgcaagccaaggacggatcctga

KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111665735
Entry
111665735         CDS       T06058                                 

Definition
(RefSeq) insulin receptor substrate 1-B-like
  KO
K16172  insulin receptor substrate 1
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal04068  FoxO signaling pathway
slal04140  Autophagy - animal
slal04150  mTOR signaling pathway
slal04910  Insulin signaling pathway
slal04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:slal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    111665735
   04150 mTOR signaling pathway
    111665735
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    111665735
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    111665735
   04920 Adipocytokine signaling pathway
    111665735
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:slal04990]
    111665735
Domain-containing proteins not elsewhere classified [BR:slal04990]
 Phosphotyrosine binding (PTB) domain-containing proteins
  IRS related family proteins
   111665735
SSDB
Motif
Pfam: IRS PH PH_11 PH_8
Other DBs
NCBI-GeneID: 111665735
NCBI-ProteinID: XP_023276573
LinkDB
Position
Unknown
AA seq 1283 aa
MDNQAGEQFSCEDVRKSGYLRKQKSMHRRYFVLRAASERGPARLEYYESEKKFRGKAPVP
KKAVALETCFNINKRADSKNKHMIVLYTRAESFAIAAENEADQDEWYQAMVDLQCKSKNP
TDSGAAGDYGVPNPGPAFKEVWQVKVWPKGLGQAKNLVGIYRLCLTDKTVNFVKLNSDAA
AVVLQLMNVRRCGHSENFFFVEVGRSAVTGPGEFWMQVDDSVVAQNMHETLLEAMKALSE
EFRQRSKSQSNSGPGGGATASNPISVPSRRHHPNPPPSQVGFTRRPRTEPPGGSNGAAGG
SSANASPTPRHSFPRSRTASDGGKGDDGIAGTTPLQGPSSSPSTNGSCSTTPILRSKSVR
SAPTTAAKTPLGLMRSISTPAPSPAPSLSSSSGHGSEFGGVTSSTGAGPGSGAYSRVPSH
RASVSGSPSDYGSSDEYGSSPGDHTLLPSPSLPGSSVGSVSSQSLGDEGANYILMGQRSS
SGGGSNQGSLTSSSLPAPGTPACGSQPQTRRVLRRSSSRECEAERRLLSKRASLPPMTLE
RLAPRQRRAEEPADEDSADYAIMSRSTSRESFTSMSSSMQRESVMGAGSAGGGGGYLDVA
GEFKSEGSGGAGGSVDLGVDNGYMSMLPGVTQPPVSLSQSLAVSVPDSDSKPTDDYMAMT
PNNSVSPPQQIRPPPTSDGYMIMSPNSSCSPDQRGGLSGGAWVGSGSADSRAGSDYMNMS
PISARSVNGSPPPPDHTGHLETSSQQQAPKMVYSYYSLPRSYKHNPSAGHFDDGPGRGRR
PNGNCSRGMGGGRTMGGRQEQQAAGNSVVGRHLSLSSSSYSSSSASSESLGESEERATQA
VNTTAGGAKSKDGSKLQQRRGSAGLSKQGSHSRSRPVSLFVDVSKANTLPRVRENPLPPE
PKSPGEYVSIEFKGEKCSQTMVGGGRGRGLRHGLSLPHCSSSQHPQHRPTSCLGNFVPLS
RSPSAPITPPAASEYVNMDLGPSPSPSPLSLTPLVFPSFHTPPTPPTLAHAPKACDEGTT
GPREEGAEVANAPLRKSRESAPSVTESESPTSCGDYTEMAFSLNSNTVPRSSSSVSPKAP
SPTRTDPSVPVLSRGLDFPLAKPGLNPDHGAKVIRADPQGRRRHCSETFLASPSLPTSNS
TSSSSTASLFPEHAQAVARRLGFENMLWGNGAVTDTPTQCPLPGQQSLPSNAQTSSTEQG
LNYIDLDLVNKESPHLGLEGPSGSQTPSRLFSVLGGGSGIGGVGAAVSSSSSSSSLNTYA
SIDFYKSEELRTHQNGSKEGTEC
NT seq 3852 nt   +upstreamnt  +downstreamnt
atggacaaccaagcgggcgagcagttcagctgcgaggacgtgcggaagagcggctacctc
cgcaagcagaagtccatgcaccggcggtacttcgtgctccgcgccgcctcggagcgcggc
ccggcccgcctggagtactacgagagcgagaagaaattccgcggcaaggcccccgtcccg
aagaaagcagtggcgctggagacctgcttcaacatcaacaagcgggccgactccaagaac
aagcacatgatcgtgctctacacccgggccgagagtttcgccatcgccgcggagaacgag
gcggaccaggacgagtggtaccaggccatggtggacctgcagtgcaaaagtaagaacccc
actgacagcggggctgcgggggactacggcgttcccaatccggggccggcgttcaaagag
gtgtggcaggtgaaggtgtggcccaaaggcctgggtcaggccaagaacttggttggcatc
taccggctttgtctgactgacaagacggtcaactttgtcaagctcaactctgatgccgct
gccgtggtgctgcagctgatgaatgtccgacgctgcggccattcagaaaacttcttcttc
gtggaggtgggacgctctgccgtgacaggcccgggcgagttctggatgcaggtggatgat
tcagtggtggcccagaacatgcatgaaaccttactcgaggccatgaaggcactgagcgag
gagtttcgccaacgcagcaaatctcagtcgaactccggccctgggggaggtgctactgcc
tctaatcctatcagcgttccttcacgccgccaccacccaaaccctcctcccagccaggtg
ggcttcacccgccgtccccgaactgaacctcctggaggctctaacggtgcagcaggaggc
agcagtgccaatgcttctcccaccccgcggcatagcttcccaaggtctcgcactgccagt
gatggggggaaaggtgacgatgggatagcagggaccacaccgctccaagggccgagctcc
agcccctccaccaatggctcttgctccaccaccccaatcctcaggtcaaagtcagtccgt
tccgcccccaccacagctgctaaaactccccttgggttgatgcgctccatctccacccca
gcgccttccccagccccaagcctctcctctagctctgggcatggctctgagtttggaggt
gtaacatcttccactggtgctggtccggggtctggtgcctacagtcgtgtcccctcgcat
cgcgcctcagtctcaggctctcccagtgactacggctcttcagacgagtatggctctagt
cctggggatcacacgctccttccatccccaagcctccctggaagctctgttggtagcgtc
agcagccaatctcttggcgatgagggggccaactacatcctgatgggccagcgcagtagt
agtggtggtggaagtaatcagggaagcttgacatccagctccctgcctgcaccaggaaca
ccagcctgcggctcccagccccagaccaggagagtgctgcgccgctcctccagccgtgaa
tgtgaagctgaacgtaggctgctgagcaagcgggcctctttacctcctatgaccctggag
agactggccccacgccagcgtagagctgaggaaccggcagatgaagattcagccgattat
gccatcatgtccaggagcaccagccgcgagtcctttacttccatgtcctcttccatgcag
agggaatctgtcatgggtgctgggtcagcagggggaggaggaggatacttggatgttgcg
ggggagttcaaaagtgaagggagtggaggggcaggtggtagtgtagatttaggtgtggac
aatgggtatatgtccatgctgcctggcgtcactcagcctccagtatccctgtcccagtca
ttggctgtctctgtcccagactcagattctaaacctactgatgattacatggccatgacc
cccaacaacagcgtgtcccctccacagcagatccggccaccgccaacttctgacggctat
atgataatgtcccccaatagcagctgctcccctgaccagcgtgggggtctctctggaggg
gcttgggtgggcagtggcagtgcagacagcagggcaggaagtgactatatgaacatgtcc
ccaatcagcgcacgttctgtaaatggcagccccccacctcctgaccacaccggtcatttg
gagaccagctcccaacagcaagcccccaagatggtgtattcttactactcccttccccgg
tcatacaaacataacccctctgctggacactttgacgatgggcccgggcgaggcagaagg
cccaatgggaattgtagtaggggaatgggtggaggtaggactatgggagggcgtcaggag
cagcaagcagcaggaaactcagtggttggacgccacctgtcactctcctcttcctcatac
tcctccagctcggccagcagtgagagccttggagagagcgaggagcgggctacccaggca
gtgaacaccacagctgggggagctaagtccaaagacgggagtaagctccagcagagacgg
ggctctgcagggttgtccaagcaaggtagccatagtagaagcagaccagtgagcctgttt
gttgatgtatccaaggctaatacccttcccagagtccgtgagaacccgctgcccccagaa
cctaagagtcctggggagtacgtaagcattgagtttaaaggggagaagtgcagccagact
atggttggaggagggcgtggcaggggtctcaggcatggcttatcactgcctcattgctca
agcagccagcatcctcaacacaggccaacttcttgcctaggtaactttgtccctctctcc
cgtagcccctctgcccccatcactcccccagctgcctccgagtatgtcaatatggacttg
ggcccttctccttccccctcaccactctctcttaccccactagttttcccatctttccac
acccctcccacgcctccaactctcgctcatgcccctaaagcctgtgatgagggtactact
ggccctcgtgaagagggggccgaagtggctaatgccccacttaggaaaagcagagaaagt
gctccatcggtgactgagtccgagtctcctacgtcctgtggagactacacagagatggcc
ttcagcttgaatagcaacaccgtccctaggtcatcatccagtgtctcccccaaagcccct
tcccccaccaggactgatccttctgttccagtactgtcacgaggtctagactttcccctt
gccaaaccaggactcaacccagaccacggggctaaagttatccgggccgaccctcaagga
cgcagacggcattgctcagaaaccttcctggcctcgccttccctccccacctctaactct
acttcctcttcctccactgcctccctatttccagaacatgcccaagctgtggcccgccgg
ctgggctttgaaaacatgttgtgggggaatggtgctgtgactgatacccccactcagtgc
cccctccctggacagcagtcccttccctcaaacgctcagacttcctccacagagcaaggt
cttaactacattgacttggacttggtcaacaaagagagtcctcatttggggctggaagga
ccctcaggtagccagaccccttctcgcctcttctccgtactgggtggaggttctgggatt
gggggagtgggcgcagcagtcagcagcagcagcagcagctccagcctcaacacttacgcc
agcatcgacttctacaaatcagaggagctgcggacacatcagaacggaagcaaggaggga
acagagtgctga

KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111667114
Entry
111667114         CDS       T06058                                 

Definition
(RefSeq) insulin receptor substrate 2-B-like
  KO
K07187  insulin receptor substrate 2
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal04068  FoxO signaling pathway
slal04140  Autophagy - animal
slal04910  Insulin signaling pathway
slal04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:slal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    111667114
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    111667114
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    111667114
   04920 Adipocytokine signaling pathway
    111667114
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:slal04990]
    111667114
Domain-containing proteins not elsewhere classified [BR:slal04990]
 Phosphotyrosine binding (PTB) domain-containing proteins
  IRS related family proteins
   111667114
SSDB
Motif
Pfam: IRS PH_11 PH
Other DBs
NCBI-GeneID: 111667114
NCBI-ProteinID: XP_023278464
LinkDB
Position
Unknown
AA seq 1418 aa
MANFTNYQEGKAAMLMVETQQRDVGTKSAAATANGDGSVGEPPSPLINIGGGGGGGGGGG
GGSRFHQHLPPSNHLHHLHLSHHHPPKDQQQHHHYQLAPQQQQQQQQQQHLSGENIAESP
GRKASSSSLSQVHTAEDPAASSSAASSSSSSSSHVYAAVNVANTSDVVDDIRKCGYLRKQ
KHGHKRFFVLRAASHLGPSRLEYYDSEKKFRNSLRSAAAAVASGGAVAPSPPKRVIYLYQ
CFTVNKRADSKNKHLIALYTKDEYFAIVAENEQEQEDWYVAVSELMSEGKKGHLDSDDLD
DGYGTVTPGTVFKEVWQVNVKPKGLGQTKNLTGVYRLCLSTKTIHLVKLNSETPCVNLQL
MNIRRCGHSESFFFIEVGRSSSIGPGEIWMQVDDSVVAQNMHETILETMKALKAFAEFRP
RSKSQSSGSNPMPFITTRRHLGNLPPSQTGLQRRSRTESVVGTPPSSKSSGASGYRFRTS
SEGEGTMNRPFRSATGSLVHLNSARAHHGRQEGGGASSGSGVATGNAGTSTSGGGRYVRA
IPGSSSTYHARSASLPVSHFPSTTSPVSVSSSSGHGSVSDTLTRPSSASICGSPSDGGFN
SSDEYGSSPGDFRYFRVRSNTPDSLGNTPPIREENCLNDYMAMGWNREVFGTSGGSGNNS
GGDTPRDESTSTTEDERFSSSSLRRRTHSFSRPAGGATGGSGVAVYQKMTQTNFSLDEGS
DVVLPFGSGLLRGGPSSSSSSLRSDYSSCSEHSQQSRPSTLSRTEAGGERPSLPSSSSSA
KEDSGYMPMMCGVAASPRDTPPDYMPMQPSSYSHHVSHSPQFHSPALGARSAHPHPQPQP
QSSTDSHGYMMMLPGGSGTSPSPVQASPSPHSSSSLAGASGSDSIAERPENGEYMDMSYS
SSAGRKLSNEGSSGYYTPGTPESTPKSYSPYFSLPRSYKAPTRERDEKEYGEYVPMSSPA
KPVYSSVATASLSTPERRVGGGSSTSTPSHPPPPYGAHHATAAMADRRIVRPNRLPLGRR
SFHGPLRVSEPSTASAGTSTSVPATGSSSEGPSSPGEYINIEFGDHYPHQQQPPAYPLSA
QDEAPSLGSSDHRHSPPQPQSHQDYMSVEVEADQQDSAGCLGKNQSPRPSLVAPWNPPSY
IRPLASNPGVLASPGVPAGGHWRSMGDDYTDMTFNLSRGERTQTSPTAMLQHLCVIEGHY
GHASSASPSSISPPLPPSSPGRAPTQQLEPKVVRADPQGRRRHSSETFSSTSSTNSTPSA
GGLGPSSSAAHPTLTNTAAPNGSYLSEGQASRWASSASFDSVWMSVEGLGDSPAHHAPVR
AMEMSAAAGTSASSSSGAGAGRMCRNMSVGYQNGLNYIALELREDGSNMGAMTSGAGSSN
GSLAAAAATVGTVPLPENGAYASIDFTKSDGVTATTKD
NT seq 4257 nt   +upstreamnt  +downstreamnt
atggcaaatttcacgaattaccaggaaggcaaggcagcgatgttgatggtggagacgcag
cagagggacgtggggacgaaatctgcggccgccaccgcaaacggagacggctcggtcggg
gaacccccttccccgttaattaatatcggcggcggcggcggcggcggaggaggaggagga
ggcggctctcgtttccatcaacatttaccgccctccaaccacctccaccatctccacctc
agccaccatcacccgccaaaggatcaacagcagcaccatcactaccagctggctccgcag
cagcagcagcagcagcagcaacagcagcatctttccggggaaaacatcgcagagtccccc
ggcaggaaagcctcctcctcgtctctcagccaggtacacacggccgaggaccccgccgct
tcctcctccgccgctagcagcagcagcagcagcagcagccatgtatacgcggctgtgaac
gtcgcaaatacctcggatgttgtggacgatatacgcaaatgtggctatttaagaaagcaa
aaacacggacacaagaggtttttcgtgctccgagcggccagtcacctcgggccgagccgc
ctggagtactacgacagcgagaagaaattcaggaacagcctgcgctccgctgccgcggca
gtcgccagcggcggagcggtcgccccttctccccctaaaagggttatttacctctaccag
tgcttcacggtaaacaaaagggcggattccaaaaacaaacacctcattgctctttatact
aaggacgagtactttgccattgtggctgaaaacgagcaggagcaagaggactggtacgta
gctgtcagtgagttgatgagtgagggcaaaaaagggcacttggattctgatgatttagat
gatggatacggtaccgtcacccctggtactgtgtttaaagaggtgtggcaggtgaatgtg
aaacctaaaggactgggtcaaactaaaaacctcacaggtgtttaccggctatgcctctct
actaaaaccatacacctcgtaaagttgaactctgaaaccccctgtgttaaccttcagttg
atgaatatcaggcgctgcggacattcagaaagcttctttttcattgaggtgggtcgctcc
tcctccatcgggcccggggagatatggatgcaggtggatgattctgtcgtggcccaaaac
atgcacgagaccatcctggagacgatgaaagccctgaaagcttttgctgagtttcggccc
aggagtaagagccaatcgtcgggctccaaccccatgccatttatcacgacacgccgccac
ctgggcaacctgccgccaagtcagactgggctgcagaggcggtcgagaacggagtcggtt
gttggtacgccgccgtcaagtaagagctctggggcaagtggttatcgcttccgtacatcc
agtgagggtgagggaacaatgaaccggccgttccgctccgccacaggaagtctggttcac
cttaactcagcacgggcccatcatggtcgtcaggagggtggcggagccagcagtggtagt
ggtgttgccacaggaaacgctggcactagcactagcggcggggggcgctatgtcagagcc
atcccgggatcatcgtccacctaccacgcccgctccgcctctctcccagtctcccacttc
ccctccaccaccagtcccgtgagcgtctcctccagcagcggccacggctccgtctccgac
acactcacccgcccatcgagcgcctcaatatgtggctccccgtctgacggcggcttcaac
tcttcagatgaatatggctccagccccggtgatttccggtacttccgggtgcggagtaac
acaccagactccctgggcaacaccccaccaatcagagaggagaactgtctaaatgactac
atggccatgggctggaaccgggaggtctttggcaccagcggggggtctggaaacaacagt
ggaggcgacacgccacgggatgagagcacgtcaacaacggaggacgaacgcttttcatca
tcgtcgctgaggaggaggacgcattctttctccagacccgccgggggtgcaaccggcggt
tctggagtggcagtttaccagaaaatgacccagaccaacttttcattggacgaagggtca
gatgtggtgttaccattcggcagtgggcttctccgtggcgggccgtcctcctcctcttcc
tcgctccgttccgactacagttcctgctccgagcacagccagcagagccgtccctccacg
ctctcccggacggaggccggtggtgagcgcccttcccttccttcctcctcctcctctgcc
aaggaagacagcggctacatgcccatgatgtgtggcgtggctgcgtcaccgcgggacacc
cctcccgactacatgcctatgcaacccagctcctactcccaccacgtctcccattccccg
cagtttcacagtccagctttaggtgcccgttcagcccacccccacccccagccccagcct
caatcctccacggactctcacggttacatgatgatgctcccagggggcagcggcacctct
ccctccccggtgcaggcctctcccagcccccacagtagctccagtttggcaggtgccagt
gggagtgacagtatagcagagagacctgagaacggggaatatatggacatgtcgtacagc
agcagtgcggggcgcaagctctcaaacgaagggagcagtgggtattatacacctgggaca
cctgagagcaccccaaagtcttacagcccatatttctcgctccctcgctcctacaaagcc
cccaccagagagagggatgagaaagagtacggggagtatgttcctatgagttctcctgcc
aagccagtctattcatcagttgccacagcgtccctgtcaacaccagagaggagggttgga
ggaggaagtagcacctccaccccatctcatccacccccgccttatggagctcatcatgcg
accgcagcaatggccgacagacgcatcgtgaggccgaaccgcctccctttaggcagaagg
agtttccacggtccactgcgggttagtgagccctccacagcgtctgcaggcacctcaacc
tcagtccccgccactggtagctcgtctgaagggccttccagtcccggagaatatattaac
attgagtttggagatcactatccccaccaacagcagccccccgcctaccctctctctgcc
caagatgaagcgccttccctggggtccagtgaccaccgtcactcccctccacagccccaa
tctcaccaggactatatgagtgtggaggtagaagcagaccagcaggacagcgctggatgt
ctgggtaagaaccagtcaccaaggcccagccttgttgccccatggaacccgcccagctac
atcagacccctggctagcaatcccggggtgctggcctcccccggagtccctgccggaggt
cactggaggtcgatgggggacgactacacggacatgacatttaacctcagcagaggtgag
aggacgcaaacgagccccacagccatgctgcagcatctctgtgtaatcgagggacattac
ggccatgcttcctctgcctccccctcatccatctcccctcccctccccccgtcgagccca
ggtagggcaccgacacagcagctggagcccaaggtggttcgagctgacccccaaggcagg
aggagacacagctcggagacattctcctccacctcctccactaattcaactccctctgca
ggaggactcggcccctcatcctcagccgcccacccaacacttacgaacaccgcagccccc
aacgggtcttacctatcagagggtcaggcttccagatgggccagctcagcatctttcgac
agtgtgtggatgtctgtggagggactaggggactcgccggctcaccacgctccagtcaga
gccatggaaatgagcgctgccgccgggacctcagcatcctcctcctcgggggccggggcc
ggtagaatgtgcaggaacatgtcggtgggctaccagaacggactgaactacattgccttg
gagctgagggaggacgggagtaatatgggagccatgacgtcgggagccggtagcagcaat
gggagcttggcggcggcggcagcaacggtggggacggtgcctctgccggagaacggcgcc
tatgccagtatcgacttcaccaaatctgatggagtcaccgcaacaaccaaggactga

DBGET integrated database retrieval system