KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111646245
Entry
111646245         CDS       T06058                                 

Gene name
tradd
Definition
(RefSeq) tumor necrosis factor receptor type 1-associated DEATH domain protein
  KO
K03171  tumor necrosis factor receptor type 1-associated DEATH domain protein
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal04010  MAPK signaling pathway
slal04210  Apoptosis
slal04217  Necroptosis
slal04622  RIG-I-like receptor signaling pathway
slal04920  Adipocytokine signaling pathway
slal05132  Salmonella infection
slal05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:slal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111646245 (tradd)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    111646245 (tradd)
   04217 Necroptosis
    111646245 (tradd)
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    111646245 (tradd)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    111646245 (tradd)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111646245 (tradd)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    111646245 (tradd)
SSDB
Motif
Pfam: TRADD_N Death DUF5677
Other DBs
NCBI-GeneID: 111646245
NCBI-ProteinID: XP_023251461
LinkDB
Position
Unknown
AA seq 292 aa
MADKTVDGGPWTGCAVMFLQSLCPRVNLLSLYKDQQGKFIIFKVIKLTLIDSAGGLGGYE
ILKVHDADPFLGVEVKFVDVTACQQFLESYSSGAVRQSVSQHACRLLALPQELTVETQLK
ASTHILDLYLDKLELCLQHIHLSQPERLRDEEIDRLEEQLQSQALGPAPQSTVITQEEPS
VPSNCFKFQNKVFEDRMLTAADVQSFSNGVGRQWKHVGRALGKSCRALKGPAIDNLAYEY
EREGLYEQAYQLLSRFIQAEGRAAKLSRLVKALEDCKLTSLAENILDIQPRE
NT seq 879 nt   +upstreamnt  +downstreamnt
atggcggacaagactgtggatggtgggccatggacagggtgtgcagttatgtttctgcag
tcgctctgcccccgtgtgaacctgctctctctctacaaagaccaacagggaaagttcatc
attttcaaagtcatcaagctgacacttatagattctgcaggaggtctggggggttacgag
atactgaaggtccatgacgctgatcccttcctgggggtggaggtgaagtttgtggacgtg
acagcatgtcagcagttcctggagagctacagctctggagcagtgcgtcagtctgtctcg
caacacgcctgccgacttcttgctctgccccaagagttaacagtggaaacccagctcaag
gccagcacacacatcctggatctctatctggacaagctggaactttgcctacagcacatc
cacctttcacagccggagcgcctgcgcgatgaagagatcgatcgtctggaggagcagctg
cagagtcaggcccttggtcctgccccacaatccaccgtcatcacacaggaagagccttct
gttcccagcaactgcttcaagtttcagaataaagtgtttgaggaccgaatgctgacagcg
gcagatgttcagagcttttctaacggagtgggccgtcagtggaaacatgtagggagggcc
ctggggaaaagctgccgggctctgaagggtccggccatagacaacctggcctacgagtat
gagagagaagggctgtatgagcaagcctatcagctgctcagccgcttcatccaggcggag
gggagagcggccaagctgagccggctggtcaaagcactggaggactgcaaactcaccagc
ctggctgaaaatattctggacatacagccacgagagtaa

DBGET integrated database retrieval system