KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111646556
Entry
111646556         CDS       T06058                                 

Definition
(RefSeq) mitogen-activated protein kinase 9-like
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal04010  MAPK signaling pathway
slal04012  ErbB signaling pathway
slal04068  FoxO signaling pathway
slal04137  Mitophagy - animal
slal04140  Autophagy - animal
slal04141  Protein processing in endoplasmic reticulum
slal04210  Apoptosis
slal04217  Necroptosis
slal04310  Wnt signaling pathway
slal04510  Focal adhesion
slal04530  Tight junction
slal04620  Toll-like receptor signaling pathway
slal04621  NOD-like receptor signaling pathway
slal04622  RIG-I-like receptor signaling pathway
slal04625  C-type lectin receptor signaling pathway
slal04910  Insulin signaling pathway
slal04912  GnRH signaling pathway
slal04914  Progesterone-mediated oocyte maturation
slal04920  Adipocytokine signaling pathway
slal05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:slal00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    111646556
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111646556
   04012 ErbB signaling pathway
    111646556
   04310 Wnt signaling pathway
    111646556
   04068 FoxO signaling pathway
    111646556
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    111646556
   04137 Mitophagy - animal
    111646556
  09143 Cell growth and death
   04210 Apoptosis
    111646556
   04217 Necroptosis
    111646556
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111646556
   04530 Tight junction
    111646556
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111646556
   04621 NOD-like receptor signaling pathway
    111646556
   04622 RIG-I-like receptor signaling pathway
    111646556
   04625 C-type lectin receptor signaling pathway
    111646556
  09152 Endocrine system
   04910 Insulin signaling pathway
    111646556
   04920 Adipocytokine signaling pathway
    111646556
   04912 GnRH signaling pathway
    111646556
   04914 Progesterone-mediated oocyte maturation
    111646556
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111646556
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:slal01001]
    111646556
Enzymes [BR:slal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     111646556
Protein kinases [BR:slal01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   111646556
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo APH RIO1 Kinase-like
Other DBs
NCBI-GeneID: 111646556
NCBI-ProteinID: XP_023251846
LinkDB
Position
Unknown
AA seq 420 aa
MSEAEGQFYSVQVGDSTFTVLKRYQQLRAIGSGAQGIVCSALDTVLGIPVAVKKLCRPFQ
NQTHAKRAYRELVLLKCVNHKNIIRLINVFTPQKSLEEFQDLYLVMELMDASLCQVIHMD
LDHERMSYLLYQILCGIRHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTACTNFMM
TPYVVTRYYRAPEVILGMKYKENVDIWSVGCIMGEMVKGSVIFQGTDHIDQWNKVIEVLG
TPSLEFMNRLMETVRNYVMNKPQYPGVSFAELFPDWAFPSDSEHDKLKTGQARDLLSKML
VIDPESRISVEEALNHPYIHVWYDPAEADAPPPQISDKQLEEREHTIEQWKELIYEEVID
WEERNKNGLMKEDCSDVVSGSASQSSSANDISSMSTEHTLASDTDSSSIDTLTGPLDESQ
NT seq 1263 nt   +upstreamnt  +downstreamnt
atgagtgaggcagagggccagttctacagcgttcaggtgggagactccaccttcactgta
ctcaagcgctaccagcagctccgtgcaatcggctctggggctcagggcatcgtctgctct
gctctagatacggtcctcggtatacctgtagctgtgaaaaagctgtgtcggcccttccag
aatcagacccatgctaagcgtgcctacagggagttggtgctgctcaaatgtgtcaaccac
aaaaatatcatccgtctgatcaatgtgttcacgcctcagaagtccctggaggaattccag
gatctgtatctggtgatggagctgatggacgccagcctgtgccaggtgatccacatggac
ttggaccatgagaggatgtcctatctgctctaccagatcctctgtggcatcagacactta
cactctgctggcattatccatagggacctgaagcccagtaacattgtggtgaagtcggat
tgtaccctgaagatcttggactttggcctggcacggacggcctgcactaacttcatgatg
accccctacgtggtgaccagatactaccgtgccccagaggtcattctgggcatgaagtat
aaagagaatgtggacatctggtcagtggggtgtatcatgggagagatggtaaagggcagc
gtcatcttccaaggcaccgaccacatcgaccagtggaataaggtcattgaggttctgggc
acacccagtctggagtttatgaaccgactgatggagactgtgaggaactatgtgatgaac
aagccacagtatcctggcgtcagctttgctgagcttttccccgactgggcctttccttct
gactcagagcacgacaaactgaagacaggtcaggcacgggacttgctgtccaaaatgctg
gtcattgatcctgagagccgtatctccgtagaagaggccctcaaccacccctacattcat
gtgtggtacgaccctgcagaagccgacgcgcctcctccccagatttcagataagcagctg
gaagagagggagcacaccatcgagcagtggaaagaactcatttatgaagaggtgattgac
tgggaggagaggaacaagaatggactaatgaaagaagattgctcagatgtggtgtcaggt
tcagcctcccagtcctcctcagccaacgacatctcatccatgtccacggagcacaccttg
gcctcggacacagacagcagcagcatcgacacactgacgggaccgctggacgagagtcag
tga

KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111656807
Entry
111656807         CDS       T06058                                 

Gene name
mapk10
Definition
(RefSeq) mitogen-activated protein kinase 10 isoform X1
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal04010  MAPK signaling pathway
slal04012  ErbB signaling pathway
slal04068  FoxO signaling pathway
slal04137  Mitophagy - animal
slal04140  Autophagy - animal
slal04141  Protein processing in endoplasmic reticulum
slal04210  Apoptosis
slal04217  Necroptosis
slal04310  Wnt signaling pathway
slal04510  Focal adhesion
slal04530  Tight junction
slal04620  Toll-like receptor signaling pathway
slal04621  NOD-like receptor signaling pathway
slal04622  RIG-I-like receptor signaling pathway
slal04625  C-type lectin receptor signaling pathway
slal04910  Insulin signaling pathway
slal04912  GnRH signaling pathway
slal04914  Progesterone-mediated oocyte maturation
slal04920  Adipocytokine signaling pathway
slal05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:slal00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    111656807 (mapk10)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111656807 (mapk10)
   04012 ErbB signaling pathway
    111656807 (mapk10)
   04310 Wnt signaling pathway
    111656807 (mapk10)
   04068 FoxO signaling pathway
    111656807 (mapk10)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    111656807 (mapk10)
   04137 Mitophagy - animal
    111656807 (mapk10)
  09143 Cell growth and death
   04210 Apoptosis
    111656807 (mapk10)
   04217 Necroptosis
    111656807 (mapk10)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111656807 (mapk10)
   04530 Tight junction
    111656807 (mapk10)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111656807 (mapk10)
   04621 NOD-like receptor signaling pathway
    111656807 (mapk10)
   04622 RIG-I-like receptor signaling pathway
    111656807 (mapk10)
   04625 C-type lectin receptor signaling pathway
    111656807 (mapk10)
  09152 Endocrine system
   04910 Insulin signaling pathway
    111656807 (mapk10)
   04920 Adipocytokine signaling pathway
    111656807 (mapk10)
   04912 GnRH signaling pathway
    111656807 (mapk10)
   04914 Progesterone-mediated oocyte maturation
    111656807 (mapk10)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111656807 (mapk10)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:slal01001]
    111656807 (mapk10)
Enzymes [BR:slal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     111656807 (mapk10)
Protein kinases [BR:slal01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   111656807 (mapk10)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like RIO1 APH FTA2
Other DBs
NCBI-GeneID: 111656807
NCBI-ProteinID: XP_023264439
LinkDB
Position
Unknown
AA seq 476 aa
MVFMSRHFLYNCSQPILDVKIAFCQGFGKQVDVSYIAKHYNMSKSKVDNQFYSVEVGDST
FTVLKRFQNLKPIGSGAQGIVCAGYDAVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKC
VNHKNIISLLNVFTPQKSLEEFQDVYLVMELMDANLCQVIQMELDHERMSYLLYQMLCGI
KHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILG
MGYKENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQLGTPSPEFMKKLQPTVRNY
VENRPKYAGLTFPKLFPDCLFPADSEHNKLKASQARDLLSKMLIIDPAKRISVDEALQHP
YINVWYDPAEVEAARDLIQLSMPPPQIYDKQLDEREHSIDEWKELIYKEVMNFEERTKNG
VVKGQPSPSGAAVNSSESLPPSSSINDISSMSTDQTLASDTDSSLETSAGPLGCCR
NT seq 1431 nt   +upstreamnt  +downstreamnt
atggtatttatgagcagacatttcttatataactgcagccaaccaatcctggatgtgaag
atagccttttgtcagggttttggaaaacaagtggatgtgtcatatattgccaagcattac
aacatgagcaaaagcaaagtggacaaccagttctacagtgtggaagtgggagactctacc
ttcacagttttaaaacgtttccagaatttaaagcccattggctctggagctcagggaatt
gtctgtgcgggctatgatgctgttctggacagaaatgtagccatcaagaagctgagcaga
cccttccagaaccagacccatgccaaaagggcataccgggagctggtgctcatgaaatgt
gtcaatcacaaaaatattatcagtttattaaatgtcttcacgccacagaaatcattagag
gaattccaggatgtgtacctagtgatggagctgatggatgccaacttgtgccaggtgatt
cagatggagcttgaccatgagagaatgtcctacctgctctaccagatgctgtgtggtatc
aaacatctgcactcagctgggattattcacagggacctcaaaccaagcaatatagtggtg
aagtcagactgcaccctgaagatcctggactttggtctggccaggactgcaggcacaagc
ttcatgatgaccccttatgtggtgactagatactacagagccccagaggttatcctgggc
atgggatacaaagagaatgtggatatatggtcggtggggtgcattatgggagaaatggtg
cgccacaaaatccttttccctggtcgggactacatcgaccagtggaacaaggtgattgag
cagctgggcacgccctcgccagagttcatgaagaagcttcagcccacagtgaggaactat
gttgagaaccggccaaagtacgcgggcctcacctttcccaagctcttccctgactgcctt
ttccctgctgactctgagcacaacaaactcaaagctagccaggccagagacctgctgtct
aagatgttgatcattgaccccgctaagcggatatcggtggacgaggccttacagcacccc
tacatcaacgtgtggtacgatccagctgaggtggaggcggccagagatctcatccagtta
tccatgcctccgcctcagatctacgacaagcagctggatgaaagagaacactccattgat
gaatggaaagaattaatctacaaagaggtgatgaactttgaggagagaacgaagaatggc
gttgtgaagggacaaccttcaccttcaggtgcagccgtgaacagcagcgagagcctccct
ccctcctcctctatcaacgacatctcctccatgtccaccgaccagaccctggcctcagac
actgacagcagcctggagacctctgcaggacccctggggtgttgcaggtga

KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111658196
Entry
111658196         CDS       T06058                                 

Definition
(RefSeq) mitogen-activated protein kinase 8-like isoform X1
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal04010  MAPK signaling pathway
slal04012  ErbB signaling pathway
slal04068  FoxO signaling pathway
slal04137  Mitophagy - animal
slal04140  Autophagy - animal
slal04141  Protein processing in endoplasmic reticulum
slal04210  Apoptosis
slal04217  Necroptosis
slal04310  Wnt signaling pathway
slal04510  Focal adhesion
slal04530  Tight junction
slal04620  Toll-like receptor signaling pathway
slal04621  NOD-like receptor signaling pathway
slal04622  RIG-I-like receptor signaling pathway
slal04625  C-type lectin receptor signaling pathway
slal04910  Insulin signaling pathway
slal04912  GnRH signaling pathway
slal04914  Progesterone-mediated oocyte maturation
slal04920  Adipocytokine signaling pathway
slal05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:slal00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    111658196
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111658196
   04012 ErbB signaling pathway
    111658196
   04310 Wnt signaling pathway
    111658196
   04068 FoxO signaling pathway
    111658196
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    111658196
   04137 Mitophagy - animal
    111658196
  09143 Cell growth and death
   04210 Apoptosis
    111658196
   04217 Necroptosis
    111658196
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111658196
   04530 Tight junction
    111658196
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111658196
   04621 NOD-like receptor signaling pathway
    111658196
   04622 RIG-I-like receptor signaling pathway
    111658196
   04625 C-type lectin receptor signaling pathway
    111658196
  09152 Endocrine system
   04910 Insulin signaling pathway
    111658196
   04920 Adipocytokine signaling pathway
    111658196
   04912 GnRH signaling pathway
    111658196
   04914 Progesterone-mediated oocyte maturation
    111658196
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111658196
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:slal01001]
    111658196
Enzymes [BR:slal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     111658196
Protein kinases [BR:slal01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   111658196
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo APH RIO1 Kinase-like
Other DBs
NCBI-GeneID: 111658196
NCBI-ProteinID: XP_023266386
LinkDB
Position
Unknown
AA seq 464 aa
MIITLRALFEQGRTFLDAQKAVIEDFAMNKNKREKEFYSLDVGDSTFTVLKRYQNLRPIG
SGAQGIVCSAYDQILERNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFT
PQKSLEDFQDVYLVMELMDANLCQVIQMELDHERLSYLLYQMLCGIKHLHAAGIIHRDLK
PSNIVVKSDCTLKILDFGLARTAATGLLMTPYVVTRYYRAPEVILGMGYQANVDIWSVGC
ILAEMVRHKILFPGRDYIDQWNKVIEQLGTPSQDFLMKLNQSVRTYVENRPRYAGYSFEK
LFPDVLFPADSDHNKLKASQARDLLSKMLVIDASKRISVDEALQHPYINVWYDPAEVEAP
PPKIPDKQLDEREHTVEEWKELIYKEVSEWEEWTKNGVIRGQPPPLGAAVIDSPPQPTSS
SSSANDVSSMSTEPTDPSSDPTMTSETDSSLDSHTSLGALACCR
NT seq 1395 nt   +upstreamnt  +downstreamnt
atgatcataacactgcgggctctcttcgaacaagggaggacatttttggatgcgcagaaa
gcagtaattgaagatttcgccatgaacaaaaacaagagagaaaaggagttctacagccta
gatgttggagactcaacattcacagtgctgaagcgataccagaatttaagacccatcggc
tcaggagcacagggtatcgtctgctcagcctatgaccaaatccttgaacgaaatgttgcc
atcaagaagctgagtcggccgtttcagaatcaaacccatgccaagagggcgtacagagag
ctcgtcctaatgaaatgtgtcaatcacaaaaatatcattggcctattaaatgtatttaca
ccccaaaaatcattagaagacttccaagatgtgtacttggtgatggagctgatggatgcc
aacctgtgccaggtcattcagatggagctggaccatgagagactgtcctatctgctctat
cagatgctgtgtggtatcaaacacctccacgctgccggcatcattcatagggacctcaag
cccagtaacattgtcgtcaagtcagattgtacactgaagattttggacttcggcttggct
cggacggccgccacgggcctcctgatgacaccgtatgtggttacgcgttactacagagcg
ccggaggttatcctgggcatgggctatcaagccaatgtggacatatggtctgtgggctgc
atactggcggaaatggttcgccataaaatcctcttcccaggaagggactacatcgaccag
tggaacaaagtaattgagcagctcggcactccgtctcaggatttcctaatgaagctgaac
cagtcagtgagaacgtacgtagaaaacaggccacgctatgctggatacagcttcgagaaa
ctcttcccagacgtgctcttcccggccgactctgatcacaacaagctgaaagcgagccaa
gcgagagatctcttatccaagatgttagtgattgatgcctccaagcgcatctccgtagac
gaggccctgcagcacccctatattaatgtttggtacgacccagcagaagtggaagcgccc
cctccgaagatcccagacaaacagttggacgagagggagcataccgtggaagagtggaaa
gagctaatttataaggaagtgagtgaatgggaggagtggacaaaaaatggagtgataaga
ggccagccacctcctttaggtgcagcagtgatcgacagcccccctcagccaacgtcctcc
tcttcttcagccaacgacgtctcatccatgtccacagagcccactgacccgagcagtgac
cccaccatgacctctgaaacagacagcagcttggacagccatacctctctgggtgcgctg
gcctgctgcagataa

KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111664771
Entry
111664771         CDS       T06058                                 

Definition
(RefSeq) mitogen-activated protein kinase 8
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal04010  MAPK signaling pathway
slal04012  ErbB signaling pathway
slal04068  FoxO signaling pathway
slal04137  Mitophagy - animal
slal04140  Autophagy - animal
slal04141  Protein processing in endoplasmic reticulum
slal04210  Apoptosis
slal04217  Necroptosis
slal04310  Wnt signaling pathway
slal04510  Focal adhesion
slal04530  Tight junction
slal04620  Toll-like receptor signaling pathway
slal04621  NOD-like receptor signaling pathway
slal04622  RIG-I-like receptor signaling pathway
slal04625  C-type lectin receptor signaling pathway
slal04910  Insulin signaling pathway
slal04912  GnRH signaling pathway
slal04914  Progesterone-mediated oocyte maturation
slal04920  Adipocytokine signaling pathway
slal05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:slal00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    111664771
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111664771
   04012 ErbB signaling pathway
    111664771
   04310 Wnt signaling pathway
    111664771
   04068 FoxO signaling pathway
    111664771
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    111664771
   04137 Mitophagy - animal
    111664771
  09143 Cell growth and death
   04210 Apoptosis
    111664771
   04217 Necroptosis
    111664771
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111664771
   04530 Tight junction
    111664771
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111664771
   04621 NOD-like receptor signaling pathway
    111664771
   04622 RIG-I-like receptor signaling pathway
    111664771
   04625 C-type lectin receptor signaling pathway
    111664771
  09152 Endocrine system
   04910 Insulin signaling pathway
    111664771
   04920 Adipocytokine signaling pathway
    111664771
   04912 GnRH signaling pathway
    111664771
   04914 Progesterone-mediated oocyte maturation
    111664771
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111664771
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:slal01001]
    111664771
Enzymes [BR:slal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     111664771
Protein kinases [BR:slal01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   111664771
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo APH RIO1 Kinase-like FTA2
Other DBs
NCBI-GeneID: 111664771
NCBI-ProteinID: XP_023275285
LinkDB
Position
Unknown
AA seq 304 aa
MNKNKREKEFYSLDVGDSTFTVLKRYQNLRPIGSGAQGIVCSAYDQILERNVAIKKLSRP
FQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKSLEDFQDVYLVMELMDANLCQVIQ
MELDHERLSYLLYQMLCGIKHLHAAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAATGL
LMTPYVVTRYYRAPEVILGMGYQANVDVWSVGCIVAEMIRGSVLFPGTDHIDQWNKVIEQ
LGTPSQDFLMKLNQSVRTYVENRPRYAGYSFEKLFPDVLFPADSDHNKLKASQARDLLSK
MLVI
NT seq 912 nt   +upstreamnt  +downstreamnt
atgaacaaaaacaagagagaaaaggagttctacagcctagatgttggagactcaacattc
acagtgctgaagcgataccagaatttaagacccatcggctcaggagcacagggtatcgtc
tgctcagcctatgaccaaatccttgaacgaaatgttgccatcaagaagctgagtcggccg
tttcagaatcaaacccatgccaagagggcgtacagagagctcgtcctaatgaaatgtgtc
aatcacaaaaatatcattggcctattaaatgtatttacaccccaaaaatcattagaagac
ttccaagatgtgtacttggtgatggagctgatggatgccaacctgtgccaggtcattcag
atggagctggaccatgagagactgtcctatctgctctatcagatgctgtgtggtatcaaa
cacctccacgctgccggcatcattcatagggacctcaagcccagtaacattgtcgtcaag
tcagattgtacactgaagattttggacttcggcttggctcggacggccgccacgggcctc
ctgatgacaccgtatgtggttacgcgttactacagagcgccggaggttatcctgggcatg
ggctatcaagccaatgtggacgtatggtcagtgggctgcatagtggccgagatgatcagg
ggaagcgtgttgttccccggcactgatcacatcgaccagtggaacaaagtaattgagcag
ctcggcactccgtctcaggatttcctaatgaagctgaaccagtcagtgagaacgtacgta
gaaaacaggccacgctatgctggatacagcttcgagaaactcttcccagacgtgctcttc
ccggccgactctgatcacaacaagctgaaagcgagccaagcgagagatctcttatccaag
atgttagtgatt

DBGET integrated database retrieval system