KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111646791
Entry
111646791         CDS       T06058                                 

Definition
(RefSeq) solute carrier family 2, facilitated glucose transporter member 1-like
  KO
K07299  MFS transporter, SP family, solute carrier family 2 (facilitated glucose transporter), member 1
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:slal00001]
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    111646791
Transporters [BR:slal02000]
 Solute carrier family (SLC)
  SLC2: Facilitative GLUT transporter
   111646791
 Major facilitator superfamily (MFS)
  Sugar transporters
   Sugar porter (SP) family [TC:2.A.1.1]
    111646791
SSDB
Motif
Pfam: Sugar_tr MFS_1
Other DBs
NCBI-GeneID: 111646791
NCBI-ProteinID: XP_023252099
LinkDB
Position
Unknown
AA seq 483 aa
MASQESHLTATLLTSILAAVLGSLQIGYHTGNINAPAKIIEEFFNHTWRARHNQSMPDHS
LTLLWSLSVSIKDFGALLGSLGVKYVADSYGRRNSILIVNCLSVVGACLMSASKACESFE
VLILGRLVFGLFCGLVMTLNPLYIQEVSPTNLRGAFATLNQVSFASGILVGMVAGLETVL
GTEHYWAMMLSLSLIPALTQYLVLPFCPESPRYLLINRGEESKAEAALLRLRGRAEKVFA
ELEEMKEEAAHTQSGVTIHEFFKKRSYKQPIIIVLIINLGSQLSGFNAIINYSTRMFQAK
FDEAKYLTLGVGAVNVTFTLVAFFLMERAGRRRLLLTGFISIAVCNLLMTIVDSVLHLAP
ELRSLQVLLVFCLISAYELGPGPISWFIAAELFDQPGRPIAMAFTSMLNWGGKFVLALLF
PPLLKVCGEYIYLLFMIVALLAFTFTWIRLPETKGRTFDDIAEEFRGAEGIPLHNKTGFN
TFT
NT seq 1452 nt   +upstreamnt  +downstreamnt
atggcgtcccaggagagccatctgactgccacgctcctgacctccatcctggcagcggtg
ctgggctccctgcagattggctaccacaccggcaacatcaatgcaccagccaagatcatc
gaagagttcttcaaccacacctggagagccagacacaaccagtcgatgccagatcacagt
ctgactctgctgtggtccctctccgtcagcattaaggactttggagccttgcttggttct
ctgggagtcaaatatgtagcagattcttatggacggcgtaactccattctaatagtgaac
tgtctctccgtggtgggagcatgtctgatgtccgcatccaaagcctgcgagtcatttgaa
gttctcatcctgggacggctggtgttcggtctgttctgcggcctggtgatgactcttaat
ccgctgtacatccaggaagtgtcccccaccaacctgagaggcgcctttgctacactcaac
caggtgtcctttgcctcgggcatcctggtggggatggttgctggtctggagacagtgttg
ggtacagagcattactgggccatgatgctgtccctgtctctcatcccggccttgacccag
tacctggtcctgcctttctgccctgagagccctcgatacctgctcatcaaccgcggagag
gagagcaaggcagaggctgccctgctgcgactgagaggcagagcagagaaagtgtttgct
gagctggaagagatgaaggaagaggccgcccacactcagagcggtgtcaccatccacgag
ttcttcaagaagcgcagctacaagcagccgatcatcatcgtcctcatcattaacttaggc
agccagctgtccggattcaacgcaatcatcaattattccaccagaatgttccaggccaag
tttgatgaggccaaatacctgactctgggtgtgggggctgtcaatgtgaccttcactttg
gtagcattcttcctgatggaaagggcagggaggaggagattgctcctgactggtttcatc
tccatagcagtgtgcaatttactcatgaccatagtcgattctgtcctgcacctggccccg
gagctgcggagcctgcaggtcctgctggttttctgcctgatttcggcctatgagctgggc
cctggccccatctcctggttcatcgcggccgagctgttcgaccagcctggcagacccatc
gccatggccttcaccagcatgctcaactggggagggaagtttgttctggcgctcctcttt
cctccattactgaaagtctgcggtgagtacatctacctcctcttcatgatcgtggctctg
ctcgccttcaccttcacctggattcgcctccctgagacgaaggggcgcacattcgatgac
attgcagaggagttcagaggagcagaggggattcctctgcacaataagactggattcaac
actttcacctga

KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111650692
Entry
111650692         CDS       T06058                                 

Gene name
slc2a4
Definition
(RefSeq) solute carrier family 2, facilitated glucose transporter member 4
  KO
K07191  MFS transporter, SP family, solute carrier family 2 (facilitated glucose transporter), member 4
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal04068  FoxO signaling pathway
slal04910  Insulin signaling pathway
slal04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:slal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    111650692 (slc2a4)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    111650692 (slc2a4)
   04920 Adipocytokine signaling pathway
    111650692 (slc2a4)
Transporters [BR:slal02000]
 Solute carrier family (SLC)
  SLC2: Facilitative GLUT transporter
   111650692 (slc2a4)
 Major facilitator superfamily (MFS)
  Sugar transporters
   Sugar porter (SP) family [TC:2.A.1.1]
    111650692 (slc2a4)
SSDB
Motif
Pfam: Sugar_tr MFS_1 Phage_holin_2_3
Other DBs
NCBI-GeneID: 111650692
NCBI-ProteinID: XP_023256382
LinkDB
Position
Unknown
AA seq 505 aa
MPAGFHQLGGETVTGTLALSVFTAVLGSLEFGYNIGVINSPQKIIEEDYNATWVHRYGEP
IPTGTLTSLWSLSVAIFPIGGMLSSFCVGFVSEWLGRRKAMLINNLLAFIGGSMMGLSKL
CRSFEMMIFGRFIIGAFCGLASGLTPMYVGEIAPTSLRGALGTLHQLAIVTGILIAQILS
LESLLGSEDLWPVLMGLTVVPTVLQMALLPFCPESPRFLYIVRCQEHHAKSGLRRLTGRQ
EVGDMLAEMKEEKRRMDMERKVSILELFRSPLYRQPTIISILLQLSQQLSGINAIFYYST
DIFRKAGVQSADYATIGAGLVNCAFTVVSLFLVERMGRRTLHMLGLGGMCICAIIMTIAL
VLLDSVPSMSYVSMLSIFGFVAFFEVGPGPIPWFFVAELFSQGPRPAAMAVAGFSNWTAN
FIIGMCFPYINKLCGAYSFLIFAALLLFFIIFTFFRVPETRGKTFDQITANFHEHSAGGM
MDMGMDMDMDKPSTELDYLGEESIN
NT seq 1518 nt   +upstreamnt  +downstreamnt
atgccggccgggtttcatcaactcggaggggagacagtgacaggaacccttgctctctca
gtcttcactgctgtgctgggatctctggagtttggatacaacatcggcgtcatcaattca
cctcagaagatcattgaggaggactataacgctacatgggtgcaccggtatggagagccc
atccccacagggaccctcacctccctctggtccctgtctgtggccatcttccccattggg
ggcatgctctcctccttctgcgtgggtttcgtctctgagtggttgggcaggaggaaagcc
atgctcataaacaatctgctggccttcattggtggaagtatgatgggtttgtccaagctc
tgtcgctcctttgaaatgatgatcttcggacgttttatcattggtgccttctgtgggttg
gcgtcaggcttgacaccaatgtatgtgggtgaaatcgctcccacgagtctgcgaggggct
ctgggcacgctgcaccaactggccatagtcactggcattctcattgcacagattctcagt
ctggagtcgttactgggcagtgaggacttgtggcctgtcctgatgggtttaaccgtcgta
ccaactgtacttcagatggcacttcttcccttctgccccgagagcccccgattcctctac
atcgtccgctgccaggagcaccacgccaagagcggcctgaggaggttaacgggcaggcag
gaggtgggcgacatgctggcagaaatgaaagaggagaagaggaggatggacatggaaagg
aaggtttccatcctggagctctttcgctctccactctaccgccagcccaccatcatctcc
atcttgctgcagctctcccagcagctgtctgggatcaacgcaattttctactactccact
gatatcttcaggaaagcaggagtgcagagtgcagactatgccaccataggagctggtttg
gtaaactgtgccttcactgtggtctcactcttcctagtagagaggatgggtcgacggaca
ctccacatgctaggactgggaggaatgtgcatctgtgccatcatcatgacgattgctctt
gttttactggacagtgttccttcgatgagctacgtcagcatgctgtcaatctttgggttt
gtcgccttcttcgaggtgggtccaggtcccatcccctggttctttgtagccgagttgttc
tctcagggtccgaggccggctgcgatggctgtggccggcttttccaactggactgccaac
ttcatcatcggcatgtgcttcccatatattaataaactttgtggggcatacagcttcctg
atcttcgcagcactcctcctcttcttcatcatcttcacattcttccgagtgccagagaca
cgggggaagaccttcgaccagattacagcaaacttccacgagcactcggcgggaggaatg
atggatatgggcatggacatggacatggacaagcccagcactgagctggattacttgggg
gaagaaagtatcaattga

KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111657929
Entry
111657929         CDS       T06058                                 

Definition
(RefSeq) solute carrier family 2, facilitated glucose transporter member 1-like
  KO
K07299  MFS transporter, SP family, solute carrier family 2 (facilitated glucose transporter), member 1
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:slal00001]
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    111657929
Transporters [BR:slal02000]
 Solute carrier family (SLC)
  SLC2: Facilitative GLUT transporter
   111657929
 Major facilitator superfamily (MFS)
  Sugar transporters
   Sugar porter (SP) family [TC:2.A.1.1]
    111657929
SSDB
Motif
Pfam: Sugar_tr MFS_1 DUF2127
Other DBs
NCBI-GeneID: 111657929
NCBI-ProteinID: XP_023266037
LinkDB
Position
Unknown
AA seq 491 aa
MDSGKQITFPLLMSVGTAVIGSLQFGYNTGVINAPQKIIEGFINDTWSQRYEEPITKSSL
TAIWSISVSIFSVGGIIGSFSVGLFVNSLGRKNSMLMANILSFIAAALMGFSKMGSSWEM
LIIGRFVVGLYSGLSTGFVPMYVGEVSPTSLRGALGTLHQLGIVLGILIAQVFGMESIMG
NDSLWPLLLGFIFVPAVIQCVLLPLCPESPRFLLINKNEENKAKTVLKKLRGTTDVSADM
QEMKEESRQMMREKKVTIIELIQSPLYRQPLIVAIILQLSQQLSGINAIFYYSTRIFEKA
GVQQPVYATIGAGVVNTAFTVVSLFVVERAGRRSLHLLGLLGMAGAAILMTIALALLEQL
KWMSYLSIVAIFAFVAFFEIGPGPIPWFIVAELFSQGPRPSAIALAGLSNWTANFIVGMG
FQYVEEACGPYVFVIFTVLLLFFFVFTYFKVPETKGRTFDEITAGFRQTAATGAEKHSPE
ELNSLGADSQL
NT seq 1476 nt   +upstreamnt  +downstreamnt
atggactcaggaaagcaaataacgttcccattgttgatgagtgttggaacagctgtgatc
ggctctctgcagtttggctacaacactggtgtcatcaatgccccccaaaagatcattgag
ggcttcattaatgacacgtggtcacagcgctatgaggagcccatcaccaagagctcccta
acggccatctggtccatctctgtctccattttctctgtcggtggcatcataggctccttc
tccgtcggactcttcgtcaacagcttaggaaggaagaactctatgctcatggctaacatc
ctgtccttcatcgcggctgctctcatgggcttctccaagatggggagctcctgggaaatg
ctgatcattggtcgctttgtggtcggcctctactccggcctctccacgggcttcgtgccc
atgtatgtaggtgaagtttccccaacgtctctacgaggagccctgggcaccctgcaccag
ctgggcattgtcctcggcatcctcatcgcacaggtgtttggaatggagtcgatcatgggc
aacgacagcttgtggccgctcctcttgggtttcatcttcgtcccagctgtgatacagtgc
gtcctgctgcctctctgccccgagagcccccgtttcctgctcatcaacaagaacgaagag
aacaaggccaagactgtgcttaagaagctgagaggcacgacagatgtgagcgctgacatg
caggagatgaaggaagagagccggcagatgatgagggagaaaaaggtgaccatcatagag
cttatccagtcacccctctaccgccagccgctcattgtcgccatcatcctgcagctctcc
cagcaactgtctggcatcaacgctatattctactattccaccagaatctttgagaaagcc
ggggttcagcagcccgtctatgccaccattggagccggtgttgttaatacagcttttact
gtggtgtcgctcttcgttgtcgaacgtgcaggacgtaggtctctgcacctgctggggctg
ctgggaatggctggggctgccatcctgatgacaattgccttggctctgctggagcagctc
aagtggatgtcatatttgagcatcgtggccatttttgccttcgtcgcgttctttgagatc
ggaccgggtcctatcccctggttcatcgtggcagagttgttctcgcagggacccaggcct
tcagccattgctctggctggtttgtccaactggactgccaacttcatcgtgggaatgggc
ttccagtatgtagaggaagcctgtggcccctacgtgtttgttatcttcactgtgctgctg
ctctttttcttcgtcttcacctacttcaaagtcccagagactaagggccggacgtttgac
gagatcacggccggcttccgccagacggccgccacaggggcagaaaagcactcgccggag
gagctcaacagcctgggagctgattctcagctctga

KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111658845
Entry
111658845         CDS       T06058                                 

Definition
(RefSeq) solute carrier family 2, facilitated glucose transporter member 1-like
  KO
K07299  MFS transporter, SP family, solute carrier family 2 (facilitated glucose transporter), member 1
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:slal00001]
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    111658845
Transporters [BR:slal02000]
 Solute carrier family (SLC)
  SLC2: Facilitative GLUT transporter
   111658845
 Major facilitator superfamily (MFS)
  Sugar transporters
   Sugar porter (SP) family [TC:2.A.1.1]
    111658845
SSDB
Motif
Pfam: Sugar_tr MFS_1 DUF2127
Other DBs
NCBI-GeneID: 111658845
NCBI-ProteinID: XP_023267286
LinkDB
Position
Unknown
AA seq 493 aa
MEGDGKVTPQLMMAVGTAVIGSLQFGYNTGVINAPQNIIESFYNETWSSRFSEPIPQTTL
TALWSLSVAIFSVGGMFGSFSVGLFVNQFGRKNSMLMANVLAFIAAVFMGFSQLAASYEM
LIIGRFIVGLYSGLSTGFVPMYVEEISPTSLRGALGTLHQLGVVIGILMAQIFGIESLMG
NASLWPLLLGFTFLPAVLQCILLPLCPESPRYLLINCNEESKARSILVKLRGTDDVSEDM
QEMREESQQMKREKKVTIAELFRSPMYRQPIFVAIMLQLSQQLSGINAVFYYSTGIFERA
GVSQPVYATIGAGVVNTAFTVVSLFVVERMGRRPLHLIGLMGMAVSAIFLTVAMALLDQL
KWMSYVSIAAIFSFVAFFEIGPGPIPWFIVAELFSQGPRPAAIAVAGFSNWSANFLVGMC
FQYVEQLCGPYVFIIFTVLLLGFFVFTYFKVPETKGRTFDEIAAGFRQSSGRGSDKYSAA
EEFSTLRGDDPDL
NT seq 1482 nt   +upstreamnt  +downstreamnt
atggagggcgacgggaaggtgacgccccagctgatgatggctgtggggacagctgtgatt
ggctctctccagtttggctacaacacaggtgtcatcaatgctcctcagaatattattgag
agcttctacaacgagacgtggagcagcaggttttcagagcccatccctcagaccacttta
acagctctgtggtcgctctctgtggccatcttctctgtgggcgggatgttcggctccttc
tctgtcggcctcttcgtcaaccagttcggcaggaagaactccatgctcatggccaacgta
ctcgccttcattgctgccgtgttcatgggcttctcccaactggctgcttcctatgagatg
ctcatcattggccggttcatagtgggtctctactctggtctgtccactggctttgtgccc
atgtatgttgaagaaatctcacccacgtctctccgtggagcgttaggaactctgcatcag
ctcggtgtcgtgatcggcattctcatggcacagatctttgggattgaatccctcatgggg
aatgcctccctgtggcccctcctgctgggttttactttcctgccagcagtgctgcagtgt
atcctgctgcccctctgccccgaaagcccccggtacctcctcatcaactgcaacgaggag
agcaaagcccgcagcatcttggtgaagctgcggggaactgacgacgtgagtgaggacatg
caggagatgagggaggagagccagcagatgaagagggagaagaaggtgaccatcgccgag
ctgttccgctcccccatgtaccgccagcccatctttgttgccatcatgctgcagctctcg
cagcagctgtctggaatcaacgctgtgttttactactcaactgggatctttgagcgagca
ggcgtgtcgcagcctgtttatgcaaccattggtgcaggagtggtcaacaccgccttcact
gtggtttctttgtttgtggtggagcgaatgggcagaagaccacttcacctcattggtttg
atgggaatggcagtttcagcaatttttctaactgttgccatggcgctgttggaccagctc
aagtggatgtcctatgtcagcattgcagccatcttcagctttgtagcattttttgaaatt
ggccctggccccattccctggttcattgtggccgagctcttcagccaggggccccggcct
gctgccattgcagttgctggtttctccaattggtctgccaacttcttagtggggatgtgc
ttccagtatgtcgagcaactctgtggtccgtacgtcttcatcatcttcacggtcctgctg
ctgggcttcttcgtcttcacctacttcaaggtgccagagaccaagggccgaacctttgat
gagattgcagcaggcttccgccagtcgtctggccgcggttctgacaaatactcagccgct
gaggagttcagcaccctcaggggggatgaccctgacctctga

DBGET integrated database retrieval system