KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111646907
Entry
111646907         CDS       T06058                                 

Definition
(RefSeq) pro-opiomelanocortin-like
  KO
K05228  proopiomelanocortin
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal04080  Neuroactive ligand-receptor interaction
slal04916  Melanogenesis
slal04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:slal00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    111646907
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    111646907
   04916 Melanogenesis
    111646907
SSDB
Motif
Pfam: NPP Op_neuropeptide ACTH_domain
Other DBs
NCBI-GeneID: 111646907
NCBI-ProteinID: XP_023252257
LinkDB
Position
Unknown
AA seq 223 aa
MCPAWILVAVVVVDVARGAVSQCWEHPSCHDLSSESSMMECIQLCHSDLTAETPIIPGNA
HLQPPPLSDPSSFILPSSSSSSSSSSSPQAKRSYSMEHFRWGKPVGRKRRPVKVYTSNGV
EEESAEVFPGEMRRRELASELLAAAEEEDKVQEVMEEAEEEEQQQLSDGEKKDGSYKMKH
FRWSGPPANKRYGGFMKSWDERSQRPLLTLFKNVINKDGQQQK
NT seq 672 nt   +upstreamnt  +downstreamnt
atgtgtcctgcgtggatattggtggcggtggtggttgtggatgtggctagaggagctgtc
agtcagtgctgggagcatccgagctgtcatgacctcagctctgagagcagcatgatggag
tgcatccagctctgtcactctgacctcaccgccgagacccccatcatcccaggcaacgcc
cacctccaacctccccctctgtcagacccctcctccttcatcctgccgtcctcctcctcc
tcctcctcctcctcctcctcacctcaggccaagcgctcctactccatggagcacttccgc
tgggggaagcccgtcggtcgcaagcgccgcccagtcaaagtctacacctctaacggcgtg
gaggaggagtctgcagaggttttccccggagagatgaggaggcgggagctggccagtgag
ttgttggcggcagcagaggaggaggacaaggtgcaggaggtgatggaggaggcggaggaa
gaggagcaacagcagctctcggatggcgagaagaaagacggttcatacaagatgaagcat
tttcgctggagtggtccgccggccaacaaacgctacggcggcttcatgaagagctgggat
gagcgcagccagaggccgctgctcacactcttcaagaacgtcatcaacaaagatggacag
cagcagaagtga

KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111650570
Entry
111650570         CDS       T06058                                 

Definition
(RefSeq) pro-opiomelanocortin-like
  KO
K05228  proopiomelanocortin
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal04080  Neuroactive ligand-receptor interaction
slal04916  Melanogenesis
slal04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:slal00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    111650570
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    111650570
   04916 Melanogenesis
    111650570
SSDB
Motif
Pfam: ACTH_domain NPP
Other DBs
NCBI-GeneID: 111650570
NCBI-ProteinID: XP_023256243
LinkDB
Position
Unknown
AA seq 249 aa
MVCLCWLLVVVMAYVCIPGFGSVCWNSSICSDLSNKGRILECIQLCMSLIKTDLPEVSTL
ALKINDDDHLLNIILGTLASSENKLSESDLQVHSDRRRSYLMEHFRWGKPPGDKILGPKL
RDHGDERRSYSMEHFRWGKPSGRKRRPIKVFASSLEGGGSSEGSFPPQARRQLNSNEDEG
KGDLNQESHQYQELLRARVSSKSHVLLSPQDRKDGTYRMSHFRWGNPPASKRNGGLMKLW
EKKNLGETG
NT seq 750 nt   +upstreamnt  +downstreamnt
atggtgtgtctatgttggttgttagtggtggtgatggcgtacgtgtgcattcctgggttt
ggatcggtgtgctggaacagctctatctgcagcgacctgagcaacaagggaaggatactg
gagtgtattcaactctgcatgtctctgatcaagactgatttgccagaggtcagtacattg
gccctgaagataaatgatgatgaccacttgctcaacatcattctgggcacactggcttct
tctgaaaacaagctatcagagtcagatcttcaagtccacagcgaccggcgacgctcatat
ttaatggagcatttccgctggggcaaaccccctggagacaagatactggggccgaagctg
agggaccacggtgacgagagacgctcctattcaatggaacatttccgctgggggaaaccc
tctggccgtaaacgcaggcccatcaaagtctttgcctcttctctggagggagggggctct
tctgagggcagctttccccctcaggctcgcaggcagctgaacagtaatgaggatgaagga
aaaggagacctgaatcaagaaagtcatcaatatcaagaattgctgagggcgagggtcagc
tccaagtcacacgtcctgttgagcccacaggacagaaaagatgggacctatcggatgagt
cacttcagatgggggaacccacctgcctccaaacgtaatggcggcttaatgaagctgtgg
gagaagaaaaacttaggggaaactggctag

KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111657888
Entry
111657888         CDS       T06058                                 

Definition
(RefSeq) pro-opiomelanocortin
  KO
K05228  proopiomelanocortin
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal04080  Neuroactive ligand-receptor interaction
slal04916  Melanogenesis
slal04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:slal00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    111657888
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    111657888
   04916 Melanogenesis
    111657888
SSDB
Motif
Pfam: Op_neuropeptide ACTH_domain
Other DBs
NCBI-GeneID: 111657888
NCBI-ProteinID: XP_023266004
LinkDB
Position
Unknown
AA seq 146 aa
SSSSSSSSSSPQAKRSYSMEHFRWGKPVGRKRRPVKVYTSNGVEEESAEVFPGEMRRREL
ASELLAAAEEEDKVQEVMEEAEEEEQQQLSDGEKKDGSYKMKHFRWSGPPANKRYGGFMK
SWDERSQRPLLTLFKNVINKDGQQQK
NT seq 441 nt   +upstreamnt  +downstreamnt
tcctcctcctcctcctcctcctcctcctcacctcaggccaagcgctcctactccatggag
cacttccgctgggggaagcccgtcggtcgcaagcgccgcccagtcaaagtctacacctct
aacggcgtggaggaggagtctgcagaggttttccccggagagatgaggaggcgggagctg
gccagtgagttgttggcggcagcagaggaggaggacaaggtgcaggaggtgatggaggag
gcggaggaagaggagcaacagcagctctcggatggcgagaagaaagacggttcatacaag
atgaagcattttcgctggagtggtccgccggccaacaaacgctacggcggcttcatgaag
agctgggatgagcgcagccagaggccgctgctcacactcttcaagaacgtcatcaacaaa
gatggacagcagcagaagtga

KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111665689
Entry
111665689         CDS       T06058                                 

Definition
(RefSeq) pro-opiomelanocortin-like
  KO
K05228  proopiomelanocortin
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal04080  Neuroactive ligand-receptor interaction
slal04916  Melanogenesis
slal04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:slal00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    111665689
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    111665689
   04916 Melanogenesis
    111665689
SSDB
Motif
Pfam: NPP ACTH_domain Op_neuropeptide
Other DBs
NCBI-GeneID: 111665689
NCBI-ProteinID: XP_023276532
LinkDB
Position
Unknown
AA seq 206 aa
MCPLWLLVAVTVVGVARGAANQCLEHASCQGDNNESSMMECIQLCRSDLTAQTPVIPGDG
HLQRPSLSDPESQPPLSLLPPSSPSSPSSPQAKRSYSMEHFRWGKPVGPKRRPIKLYTSN
GVEEESAEDFPEEMMRREPEDEPEQLHDVQEKKDSTYKMKHFRWSGPPASKRYGGFMKSG
DERSMRPLLTLLKNIDKDGQEQKTEH
NT seq 621 nt   +upstreamnt  +downstreamnt
atgtgtcctttgtggctattggtagctgtgacggttgtgggcgtggccaggggagccgcc
aatcagtgcttagagcatgccagctgtcagggtgacaacaatgagagcagcatgatggag
tgtatccagctctgtcggtccgacctcaccgcccagacgccagtcatcccgggcgatggt
catctccaacgtccctctctgtcagacccagagtctcagcctcccctctctcttttacct
ccctcctctccctcctctccctcctcccctcaggccaagcgctcctactccatggagcat
ttccgctggggaaaaccggttgggccaaagcgccgcccgatcaaactctacacctccaat
ggtgtagaggaggagtcagccgaggatttccccgaagagatgatgaggcgggaaccagag
gacgagcctgagcagctccatgacgtccaggagaaaaaagacagcacatacaagatgaag
cacttccggtggagcggcccgccggccagcaagcgctacggtggcttcatgaagagcggg
gacgaacgcagcatgagaccactgctcacactcctcaaaaacatcgacaaagatggacag
gagcagaagacagagcactga

DBGET integrated database retrieval system