KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111646990
Entry
111646990         CDS       T06058                                 

Gene name
epo
Definition
(RefSeq) erythropoietin
  KO
K05437  erythropoietin
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:slal00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111646990 (epo)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:slal04052]
    111646990 (epo)
Cytokines and growth factors [BR:slal04052]
 Cytokines
  CSF and other factors
   111646990 (epo)
SSDB
Motif
Pfam: EPO_TPO
Other DBs
NCBI-GeneID: 111646990
NCBI-ProteinID: XP_023252368
LinkDB
Position
Unknown
AA seq 185 aa
MLQKTGRGLLALLLIVLEWTRPGLPSPLRPICDLRVLNHFIKEARDAEVAMKSCRDGCSL
SDSVTVPQTRVDFDVWEKKNALEQAQEVQAGLWLLQQALSLLRSSATNTALHSHIDNSIR
NLHSINAVLRSLNIQEYTPPGSAAGLEGTWTVSSAADLLQVYVNFLRGKVRLLLSDAQAC
QQDVS
NT seq 558 nt   +upstreamnt  +downstreamnt
atgttgcagaaaacgggtagaggactgcttgccttgctgttgatagtgttggagtggacc
cggccaggcctaccgtccccactgaggccaatctgtgacctgagggtcctgaaccatttc
attaaagaagcacgagacgcagaagtcgctatgaagtcatgtagagacggatgcagcctg
tcagattctgtcactgttcctcaaaccagagtcgactttgatgtctgggagaagaaaaat
gcactggagcaagcccaggaggtgcaggctggcttatggcttttacaacaggccctcagc
ttgctacggtcctcggccaccaacacagcactgcacagtcacatagataactccattaga
aacctgcacagcatcaatgcggtgctgcgtagtctcaacatccaggaatataccccacca
ggaagtgcggctggccttgagggaacatggacggtgtcctcagcagcagatttgcttcaa
gtctatgtcaatttcttgcgaggcaaagtgcgcctcctcctttcggatgcacaggcttgt
cagcaagatgtcagctga

DBGET integrated database retrieval system