KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111647918
Entry
111647918         CDS       T06058                                 

Definition
(RefSeq) TNF receptor-associated factor 2-like
  KO
K03173  TNF receptor-associated factor 2 [EC:2.3.2.27]
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal04010  MAPK signaling pathway
slal04141  Protein processing in endoplasmic reticulum
slal04210  Apoptosis
slal04217  Necroptosis
slal04621  NOD-like receptor signaling pathway
slal04622  RIG-I-like receptor signaling pathway
slal04920  Adipocytokine signaling pathway
slal05132  Salmonella infection
slal05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:slal00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    111647918
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111647918
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    111647918
   04217 Necroptosis
    111647918
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    111647918
   04622 RIG-I-like receptor signaling pathway
    111647918
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    111647918
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111647918
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    111647918
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:slal03019]
    111647918
   04121 Ubiquitin system [BR:slal04121]
    111647918
Enzymes [BR:slal01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     111647918
Messenger RNA biogenesis [BR:slal03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     111647918
Ubiquitin system [BR:slal04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRAF proteins
    111647918
SSDB
Motif
Pfam: TRAF_BIRC3_bd zf-TRAF zf-C3HC4 zf-RING_4 zf_C2HC_14 zf-C3HC4_2 zf-C3HC4_4 MATH zf-RING_6 zf-C3HC4_3 Sina zf-RING_5
Other DBs
NCBI-GeneID: 111647918
NCBI-ProteinID: XP_023253383
LinkDB
Position
Unknown
AA seq 569 aa
MAAQEPSPPSSLEGNKPGFPKKILANNLEDKHLCNSCQKILRRPLQAQCGHRFCSFCFNK
IVSSGPQKCSACIKEDLFEEPTSILKQGGAFPDNAARREVEALAAVCPNEGCTWTGTIKE
FEAGHEGNCDFMIILCPSCKELMRANEQERHNERECPERTLNCKYCKEPFLLKNIKAHDE
ICPKYPMICEGCAKKKIPREKYVDHIKFCSKFKAPCRFHVVGCDTSVEKEKIHDHERQCS
YEHLNLLLHFIMGIKVSLESLQPQSLEVASHKLQELHQSLRDLEQKMSQLGGGGGAAPVQ
GACAPTLATSFTPLPSAMGAALELQLQSEKTKVAELSRRCQELELKVSTFENIVCVLNRE
MERSCTTMEAYNRQHRLDQDKIEILNNKVRQLERTVSLRDLSIVEMEGKMREMSAATYDG
IFVWKISDFTKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFV
VMRGHSDALLKWPFNQKVTLMLLDQNNREHIIDAFRPDISSSSFQRPVSDMNIASGCPLF
CSLSKLDSKNSYIRDDTIFIKAIVDLTGL
NT seq 1710 nt   +upstreamnt  +downstreamnt
atggctgcgcaggaaccgtctccaccatcttccctggaaggcaacaaaccgggtttccct
aagaaaattttggccaacaacctcgaagacaagcatctgtgcaattcatgccagaagata
ctgagaaggcccctgcaggcccagtgtggtcaccgcttttgttcgttctgtttcaacaaa
attgtgagctccggaccacagaaatgcagtgcctgcatcaaagaagacttatttgaggaa
cccacctctattctcaaacaaggtggtgctttcccagacaatgcagctcggcgagaagta
gaggccttggcggctgtctgtcccaacgagggatgtacgtggacggggactatcaaagaa
tttgaggccggccatgagggcaactgtgacttcatgatcatcctgtgtccttcctgtaaa
gagctgatgagagccaacgagcaggaacgccacaacgagagagagtgtccagagaggacg
ctcaactgcaaatactgcaaagaacccttcttactgaagaacatcaaggctcatgatgaa
atctgtccaaagtacccaatgatttgtgaaggttgtgcaaagaaaaagatccccagagaa
aagtatgtggaccatattaagttctgcagtaaatttaaagcaccatgcagatttcatgtt
gttggctgcgatacgtctgtggagaaagagaagattcatgaccatgagcgccagtgttcc
tacgaacacctcaacctgctcctgcatttcatcatgggcatcaaggtgagcctggaaagc
ctgcagccccagagcctggaggtcgccagccacaagctgcaggagctccaccagtccctc
agggacctggagcagaagatgagccagctgggtggaggggggggtgcagctcctgtgcag
ggtgcgtgcgccccgaccctggccacctccttcaccccgctgcccagcgccatgggcgcc
gccctggagttacagctccagagtgaaaagaccaaagtggcggagctgagccggcgctgc
caggagctggagctcaaagtgagcacgttcgagaacatcgtgtgcgtcctcaaccgagag
atggagcgttcctgcaccaccatggaggcctacaaccgccaacaccgactggaccaggac
aagatcgagatcctcaacaacaaggttcgtcagctggagaggacggtgagtctcagagac
ctgtccatcgtggagatggaggggaaaatgagggagatgtctgcggccacgtacgacggc
atctttgtctggaagatctcagatttcaccaagaagagacaggacgccgtggccggccgt
gcccccgctatgttctctcctgccttttataccagtaaatacggctacaagatgtgcctg
cggatctacctgaacggcgatgggaccggccgcggcacccacctgtctctgttctttgtg
gtgatgagaggacacagcgacgcactcctcaagtggccttttaatcagaaggtcacccta
atgctgcttgaccagaacaacagggagcacataatcgacgccttccggcccgacatctcc
tcctcgtccttccagaggcccgtcagtgatatgaacatcgccagcggctgtccactcttc
tgttcgctctccaaactggactctaaaaactcctacatacgagatgacaccatattcatc
aaggccatcgtagacctcactggactctag

KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111664872
Entry
111664872         CDS       T06058                                 

Definition
(RefSeq) TNF receptor-associated factor 2-like
  KO
K03173  TNF receptor-associated factor 2 [EC:2.3.2.27]
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal04010  MAPK signaling pathway
slal04141  Protein processing in endoplasmic reticulum
slal04210  Apoptosis
slal04217  Necroptosis
slal04621  NOD-like receptor signaling pathway
slal04622  RIG-I-like receptor signaling pathway
slal04920  Adipocytokine signaling pathway
slal05132  Salmonella infection
slal05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:slal00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    111664872
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111664872
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    111664872
   04217 Necroptosis
    111664872
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    111664872
   04622 RIG-I-like receptor signaling pathway
    111664872
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    111664872
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111664872
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    111664872
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:slal03019]
    111664872
   04121 Ubiquitin system [BR:slal04121]
    111664872
Enzymes [BR:slal01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     111664872
Messenger RNA biogenesis [BR:slal03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     111664872
Ubiquitin system [BR:slal04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRAF proteins
    111664872
SSDB
Motif
Pfam: TRAF_BIRC3_bd zf-TRAF zf-C3HC4 zf-C3HC4_4 zf-C3HC4_3 zf-RING_2 zf-C3HC4_2 zf-RING_5 zf-RING_6 ATG16 Tropomyosin_1 Paramyxo_NS_C Noelin-1
Other DBs
NCBI-GeneID: 111664872
NCBI-ProteinID: XP_023275438
LinkDB
Position
Unknown
AA seq 520 aa
MARISLDCPSSLPGIPLSVLSVPMENKYKCQQCLQVLRRPVQAQCGHRFCVHCFKQLTSS
GPKPCEACRQEEIYEEPISILNSNEAFPDNAAGREIASLPARCLNQGCDWTGSIKEYEAQ
HEGRCEFERIQCDACQTLILRTEKDRHNERECEARTLNCKYCKMTFNFKDIKAHDEICLK
FPLHCKECGKKKIPREKFNDHSRTCPRSKSACPFSEVGCKSVIENGKLSDHEHSSTMEHL
RLLLPMVMSVARARTEAPGPGEWQEDSGLSLYRAPEEGDVMGAGAAASAQSVDLEKKVNA
LENIVCVLNREVERSSVTLEAFSHQHRLDQEKIENLSNKVRQLERTLTMRDLQLSETEQL
LQELQFCTYDGIFVWKITEFSRRRQDAVAGRTPAMFSPAFYSSKYGYKMCLRLYLNGDGT
GRGTHLSLFFVVMRGKYDALLKWPFSQKVTLMLLDQNNREHIIDAFRPDVTSTSFQRPIS
EMNIASGCPLFCPLAKLAGKSPYLRDDTIFIKAIVDLTGL
NT seq 1563 nt   +upstreamnt  +downstreamnt
atggcccgaatctcgttggactgtcccagctctttaccagggatccccctcagtgtgctg
tcagtgcccatggagaataaatacaaatgtcagcagtgtctccaggtcctgaggaggcct
gtccaggctcagtgcggccaccgcttctgtgtacactgcttcaagcaactcaccagctct
ggcccaaagccttgtgaagcctgccgccaagaggaaatatatgaggagcctatttccatt
ctgaatagtaatgaggcatttccagacaatgcagcaggtcgagaaattgcaagtctgcca
gccaggtgtttgaaccagggctgcgattggacaggctcaataaaagagtatgaggctcag
catgaaggtcgctgtgagtttgagcggatacagtgcgacgcctgccaaaccttgatcctt
cgtacagagaaggatcgacataatgagagagaatgtgaggcaagaacgctcaactgcaaa
tactgcaaaatgaccttcaactttaaagacatcaaggcccacgatgaaatctgcctgaag
tttcccttacattgcaaggagtgtggcaagaagaagatcccaagagaaaagttcaatgat
cacagcagaacctgtcccaggtcaaagagcgcctgtccattcagtgaagtgggctgcaaa
tctgtgatagagaacgggaagctcagtgaccatgagcacagcagcaccatggagcacttg
cgtctgctgctgcccatggtgatgtcagtggctcgggcacgtacagaggctcctggtccc
ggggagtggcaggaggactctggtctgagcctgtacagggctcctgaggagggagacgtt
atgggcgccggagctgcagcctctgcacagtctgtggatctggaaaaaaaggtgaacgct
ttagaaaacatcgtgtgtgtcctgaatcgggaagtggagcgcagttcagtaacattggag
gctttctcacatcaacatcgtttagaccaagaaaagattgaaaatctgtccaacaaagta
cgacagctagagagaacgctgactatgagagacttgcagctgtctgagaccgaacagctg
ctccaagaactccagttctgcacttacgatggaatatttgtctggaagattactgaattc
tctcgccgcagacaggatgctgtggctggtcgaacacctgcaatgttctcacctgcattt
tactccagcaaatatggctacaaaatgtgtctgaggctgtatttgaacggtgatggaacc
ggtcgaggaacacacctttcactgttctttgttgtcatgaggggcaagtatgacgctctg
ctcaaatggccattcagtcagaaggtgactctaatgcttttggatcagaacaacagggag
cacattatcgatgctttccgccctgatgtcacctccacctccttccaacggccaatcagt
gagatgaacatcgccagtggctgcccgctgttctgtccactggctaaactggctggcaag
agcccctatctgagagatgacacaatcttcattaaagccattgtagacctcaccggctta
taa

KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111666015
Entry
111666015         CDS       T06058                                 

Definition
(RefSeq) TNF receptor-associated factor 2-like
  KO
K03173  TNF receptor-associated factor 2 [EC:2.3.2.27]
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal04010  MAPK signaling pathway
slal04141  Protein processing in endoplasmic reticulum
slal04210  Apoptosis
slal04217  Necroptosis
slal04621  NOD-like receptor signaling pathway
slal04622  RIG-I-like receptor signaling pathway
slal04920  Adipocytokine signaling pathway
slal05132  Salmonella infection
slal05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:slal00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    111666015
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111666015
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    111666015
   04217 Necroptosis
    111666015
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    111666015
   04622 RIG-I-like receptor signaling pathway
    111666015
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    111666015
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111666015
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    111666015
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:slal03019]
    111666015
   04121 Ubiquitin system [BR:slal04121]
    111666015
Enzymes [BR:slal01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     111666015
Messenger RNA biogenesis [BR:slal03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     111666015
Ubiquitin system [BR:slal04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRAF proteins
    111666015
SSDB
Motif
Pfam: TRAF_BIRC3_bd zf-TRAF SlyX zf-C3HC4_2 zf-C3HC4 zf-RING_6 zf_C2HC_14 zf-C3HC4_4 ATG16 MATH Tropomyosin_1
Other DBs
NCBI-GeneID: 111666015
NCBI-ProteinID: XP_023276969
LinkDB
Position
Unknown
AA seq 597 aa
MATQEPSPPSSMESNKPGFPKKILGNKLEDKHLCNCCHNILRRPFQAQCGHRFCSYCFNR
TVSSGPQKCNACIKEDIFEDPTSILKQGCAFPDNAVRREVENLSAVCVNESCTWKGSIKE
YELNHEGKCEFMIIPCPSCKERIRFNEQERHNERECPERTLNCKYCKEPFHFKNIKAHDE
ICPKYPMICEGCAKKKIPREKYVDHIKFCSKFRTPCRFHVVGCDMSVEKEKIHDHERAYA
YEHLNLLLHYIMGMKVSMEGLQPQGLELAGHKLVELQQSLRELEARVSQLSTTSSGPPVQ
GAAAASSSSSSSGPPGPPTSAPLPPPPTLAPTLSVSTSFTPLPSSVGAALELQLHSEKTK
VAELGRRCTELEVKAGTFENVVCVLNREVERFATTMEASNRQHKLDQDKIEALSNKVRQL
ERTVGLKDLTVAEMEGRLREMSATTFDGVFVWRISDFAKKRQDAIAGRAPAMFSPAFYTS
KYGYKMCLRIYLNGDGTGRGSHLSLFFVVMRGLSDALLKWPFNQKVTLMLLDQSNREHII
DAFRPDVTSSSFQRPVSEMNIASGCPLFCPLSKLDAKNSYIRDDTIFIKAIVDLTGL
NT seq 1794 nt   +upstreamnt  +downstreamnt
atggccacacaggaaccgtcccctccctcgtccatggagagcaataaacccggcttcccc
aagaagatcctgggcaacaagctggaggacaagcacctgtgcaactgctgccacaacata
ctgagacgaccatttcaagcccagtgtggacatcgcttctgttcctactgcttcaacagg
acagtgagtagcggaccccagaaatgcaacgcctgcattaaagaggatatttttgaggat
cccacgtcgattctgaaacaaggatgtgcttttcctgacaacgcagttcggagggaagtt
gaaaacctgtcagctgtttgcgtcaatgaaagttgcacttggaaaggcagcattaaagag
tacgagctgaaccacgaggggaagtgcgagttcatgatcatcccctgcccctcctgcaaa
gaacgaattcgcttcaacgaacaggagcgccacaacgagcgcgagtgcccggagagaacg
ctcaactgcaagtactgcaaggagccgtttcacttcaaaaacatcaaggcgcatgatgag
atctgtcccaagtacccgatgatctgtgaaggctgcgccaagaagaaaatacccagagag
aagtatgtggaccacattaagttctgcagcaaattcagaactccgtgtcgatttcatgtc
gtgggatgtgacatgtctgtggagaaggaaaagattcatgaccatgagcgcgcctacgcc
tacgagcacctgaacctgctgctgcactacatcatgggcatgaaagtgagcatggagggc
ctgcagccccagggactggaactggccggacacaaactggtggaactgcaacagtccctc
agggagctcgaggccagagtctcccagctcagcaccacctcctctgggcctcccgtgcag
ggagccgccgccgcctcctcctcatcctccagctccggcccccccggtcctcctacatca
gcccctctccctccgcctcccactctggctcccactctctccgtgtctacctccttcacg
cctttgcccagctcggtgggagcggcgctggagctccagctccacagcgaaaagaccaag
gtggccgagctgggccgcaggtgcaccgaactggaagtcaaagccggcacgttcgaaaat
gtggtgtgtgtcctgaaccgagaggtggagaggttcgccaccaccatggaggccagcaac
cgtcagcataaactggaccaggacaagatcgaggcgctgagtaacaaggtgcgacagctg
gagaggacggtggggctgaaggacctgacggtggctgagatggagggccggctgagggaa
atgtccgccactacctttgacggcgtctttgtctggaggatctctgatttcgccaagaag
agacaggacgccatcgcaggtcgagcccccgccatgttctcaccagccttctacaccagt
aagtacggctataagatgtgtctgcggatctatctgaacggagatgggacggggcgcggc
agccacttgtccttgttctttgtggtgatgaggggactgagcgacgccctgctcaaatgg
cccttcaaccagaaggtgactctgatgctgctggaccagagcaacagggagcacatcatc
gacgcctttcgacccgacgtcacttcctcctccttccagaggcccgtgagcgagatgaac
atcgccagcggctgtccgctcttctgcccgctctccaagctcgacgccaaaaactcttac
atccgcgacgacaccatcttcatcaaggcgatcgtggacctcaccggcctctag

DBGET integrated database retrieval system