KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111648212
Entry
111648212         CDS       T06058                                 

Definition
(RefSeq) phosphoenolpyruvate carboxykinase, cytosolic [GTP]-like
  KO
K01596  phosphoenolpyruvate carboxykinase (GTP) [EC:4.1.1.32]
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal00010  Glycolysis / Gluconeogenesis
slal00020  Citrate cycle (TCA cycle)
slal00620  Pyruvate metabolism
slal01100  Metabolic pathways
slal03320  PPAR signaling pathway
slal04068  FoxO signaling pathway
slal04910  Insulin signaling pathway
slal04920  Adipocytokine signaling pathway
Module
slal_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:slal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    111648212
   00020 Citrate cycle (TCA cycle)
    111648212
   00620 Pyruvate metabolism
    111648212
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    111648212
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    111648212
   04920 Adipocytokine signaling pathway
    111648212
   03320 PPAR signaling pathway
    111648212
Enzymes [BR:slal01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.32  phosphoenolpyruvate carboxykinase (GTP)
     111648212
SSDB
Motif
Pfam: PEPCK_GTP PEPCK_N
Other DBs
NCBI-GeneID: 111648212
NCBI-ProteinID: XP_023253801
LinkDB
Position
Unknown
AA seq 635 aa
MSSLLLGAIRRQGGVGAGVRIRSLASIPSLPPAVTEFVKGAMEECKPAGVHVVTGTPEET
ANILAGLEKEGMVKKLPKYDNCWLARTDPKDVARVESKTVIVTKTQRDTIPIPTGGVQSQ
LGSWMCESDWHKAREERFPGCMAGRTMYVIPFSMGPVGSSLSKYGVQVTDSPYVVASMGI
MTRMGTPVLKKLAEGAEFVRCQHSLGRPLPLRAPLLNSWPCNPDKVLISHLPDSRQILSF
GSGYGGNSLLGKKCFALRIASRIAKDEGWLAEHMLILGITNPQGVKRYIAAAFPSACGKT
NLAMMKPALPGWKVECVGDDIAWMKFDSQGKLRAINPENGFFGVAPGTSDKTNPYAMATI
AKNTMFTNVGETSDGGVWWEGLDPPQVGITLTDWHGKTWKQGSLTPCAHPNSRFCAPAAQ
CPIIDPQWESEEGVPIDAIIFGGRRPEGVPLVYESFNWQHGVFVGAAMRSEATAAAEHKG
KVIMHDPFAMRPFFGYNFGDYLAHWLSMESRKAPTHLPKIFHVNWFRKDATTGAFLWPGF
GENARVLEWIFKRCSRERQDEAAKKSIIGWLPEDGAIDTKGLSGKVDMGALFDVPKPFWQ
RETKELRAYFTQQVGVDLPAQVEAELKALEDRVHM
NT seq 1908 nt   +upstreamnt  +downstreamnt
atgtcgagtcttttattgggagccatccggagacagggtggtgttggggcaggtgtcagg
attcggtcactggcctcaatcccctcgctgcccccagcggtgactgagtttgtgaaggga
gccatggaggagtgtaagcccgctggtgtacatgtggtcacgggaacgccagaggaaaca
gccaacatcctggcaggtctggagaaggaagggatggtcaagaagcttcccaaatatgac
aactgttggttggcacgtacagatccaaaagacgtggctcgggtggagagcaagaccgtg
attgtgaccaagacccagagggacaccattcccatccctactggtggggtgcagagccag
ctgggaagctggatgtgtgagtcagactggcataaagccagagaggagcgtttccctggc
tgcatggcaggtcggaccatgtacgtgattcccttcagtatgggtcctgtaggctccagt
ctgagtaaatatggcgtccaggtgacagactccccgtacgtcgtggccagtatgggcatc
atgacgcgtatggggacacctgtcttgaagaaactggctgaaggagcagagtttgtccgc
tgtcagcactctttgggacgacctttacctctcagagcccctctgctcaactcatggccc
tgtaacccagacaaggtgctgatatctcacctgccggacagtaggcagatcctgtccttt
ggcagtggctatggaggaaattctctccttgggaaaaagtgcttcgccctccgcattgcc
tcccgcattgccaaggacgagggctggctggcagagcacatgcttatcctgggtatcacc
aaccctcagggagtgaagcgttacatagcagcggcattccccagtgcctgtggtaaaacc
aacttggccatgatgaaaccagctttgccaggatggaaagttgagtgtgtgggagacgac
atagcatggatgaagtttgacagccaaggtaaactgagggccatcaacccagagaatggt
ttcttcggtgtagctccaggtacctcagacaagaccaacccatatgccatggccaccatt
gccaaaaacaccatgttcactaatgttggtgagaccagcgatgggggagtgtggtgggaa
ggacttgacccacctcaagtcggcatcacactcacagactggcatggcaaaacttggaag
caaggaagcttgacaccttgtgcccaccccaactcccgtttctgtgccccagcggctcag
tgtcccatcattgacccccagtgggagagtgaggaaggggttcccattgacgccataatc
tttggtggcaggaggccagaaggagtccctctggtctacgagtctttcaactggcagcac
ggggtctttgttggagctgcaatgaggtctgaggccacagcagctgctgagcataagggc
aaggtgattatgcatgaccccttcgccatgcggccattcttcggctacaactttggcgac
taccttgctcactggctgagcatggagagccgaaaggctcccactcatctgcccaagatc
ttccatgtcaactggttcagaaaggatgccaccaccggcgccttcctctggcctggcttt
ggtgaaaacgcacgcgtgctggagtggatcttcaagcgttgcagccgggagaggcaggat
gaggcagccaagaagagcattattggctggctgccagaagatggcgccattgatactaaa
ggcttgagtggcaaggtggatatgggtgccttgtttgatgtgcccaagcctttctggcag
agggagaccaaagagttgagagcctacttcactcagcaagttggagttgacctgccagct
caggtggaggctgagctgaaggcacttgaggacagagtacacatgtaa

KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111652122
Entry
111652122         CDS       T06058                                 

Gene name
pck1
Definition
(RefSeq) phosphoenolpyruvate carboxykinase, cytosolic [GTP]
  KO
K01596  phosphoenolpyruvate carboxykinase (GTP) [EC:4.1.1.32]
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal00010  Glycolysis / Gluconeogenesis
slal00020  Citrate cycle (TCA cycle)
slal00620  Pyruvate metabolism
slal01100  Metabolic pathways
slal03320  PPAR signaling pathway
slal04068  FoxO signaling pathway
slal04910  Insulin signaling pathway
slal04920  Adipocytokine signaling pathway
Module
slal_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:slal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    111652122 (pck1)
   00020 Citrate cycle (TCA cycle)
    111652122 (pck1)
   00620 Pyruvate metabolism
    111652122 (pck1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    111652122 (pck1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    111652122 (pck1)
   04920 Adipocytokine signaling pathway
    111652122 (pck1)
   03320 PPAR signaling pathway
    111652122 (pck1)
Enzymes [BR:slal01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.32  phosphoenolpyruvate carboxykinase (GTP)
     111652122 (pck1)
SSDB
Motif
Pfam: PEPCK_GTP PEPCK_N
Other DBs
NCBI-GeneID: 111652122
NCBI-ProteinID: XP_023258042
LinkDB
Position
Unknown
AA seq 624 aa
MPPQLQSQNQNGPKILQGDLSALSPAVREFVDTNVSLCQPDALHVCDGSDEENRAILTQL
EEQGMIRRLRKYENCWLARTDPRDVARVESKTVIVTREQRDTVPTPLGGGVSQLGRWMSP
EELDKAVTQRFPGCMKGRTMYVIPFSMGPVGSPLSKIGVELTDSPYVVASMRVMTRMGKA
VLSALGNGEFVQCLHSVGCPLPLKKPLVNNWPCNPEQTLIAHIPDRRQIVSFGSGYGGNS
LLGKKCFALRIASRIAKEEGWLAEHMLILGVTNPAGEKKYMAAAFPSACGKTNLAMLCPT
LPGWKVECVGDDIAWMKFDDQGNLRAINPENGFFGVAPGTSAKTNPNAMATIVKNTLFTN
VAETSDGGVYWEGMDQSLPEEVTITSWKNKPWSSEDGEPCAHPNSRFCTPAGQCPIIDPL
WESPEGVPIEAVIFGGRRPEGVPLVYEAFSWQHGVFVGAAMRSEATAAAEHKGKVIMHDP
FAMRPFFGYNFGQYLSHWLSMADRPGAILPKIFHVNWFRKSPTAGFLWPGFGDNIRVLDW
MFRRVNGEAGAMPSAVGYLPCGDSLNLQGLREHVDLDQLFSLDQEFWQREVEEVRKYFTT
QVNDDLPNEMARQLDLLQQRVKQM
NT seq 1875 nt   +upstreamnt  +downstreamnt
atgcctcctcagctccagtcccagaaccagaacggacccaagatcctgcagggcgacctc
agcgccctcagcccggccgtcagggagttcgtggacaccaacgtgagcctgtgtcagccc
gacgccctgcacgtctgcgacggctccgacgaggagaaccgagccatcctgacccagctg
gaggagcaggggatgatcaggaggctgcgcaaatatgagaactgctggttggcgaggacc
gacccgagggacgtggctcgtgtggagagtaagacggtgattgtgacccgggaacagagg
gacacggtgcccacgccgctgggaggaggagtcagtcagctgggccgctggatgtccccg
gaggagttggacaaagccgtgactcagcggttcccgggctgcatgaaaggtcggaccatg
tatgtgattcccttcagcatgggtcccgtgggttcccccctctccaagatcggagtggag
ctgaccgactcgccctacgtggtcgccagtatgagagtgatgacccggatggggaaggcc
gtgctgtccgctctgggaaacggcgagtttgtccagtgtctgcactcggtcggctgtcct
ctgccgctcaaaaagccgctggtgaacaactggccctgtaaccccgagcagacgttgatc
gcccacatcccggaccgccggcagatcgtctcgttcggcagcggttacggaggaaactcc
ctcctgggaaagaagtgcttcgccctgcgcatcgcctcgcgcatcgccaaggaggagggc
tggctggccgagcacatgctgatcctgggcgtcaccaaccctgcgggggagaagaagtac
atggcggcggcgttccccagcgcctgcgggaaaacaaacctggccatgctctgccccacg
ctgccgggctggaaggtcgagtgcgtgggcgacgacatcgcctggatgaagtttgacgac
caaggaaacctccgcgccatcaacccagagaacggcttcttcggcgttgcacccggcacc
tcggccaaaaccaaccccaacgccatggcaaccatcgtcaagaacaccctcttcaccaat
gtggcggagaccagcgacggcggggtgtactgggagggaatggatcagtcgctgccggag
gaagtcaccatcacatcctggaagaacaaaccctggagctcggaggatggtgaaccctgt
gctcatcccaactctcgtttctgcactccggccggtcagtgccccatcatcgacccgctg
tgggaatccccagagggagtccccatcgaggccgtcatcttcggaggccgcagaccagaa
ggtgtccctctggtctacgaggccttcagctggcagcacggagtgtttgtcggagcggcc
atgagatcggaggccacggctgcagctgaacacaaaggtaaggtgatcatgcacgacccg
ttcgccatgcgtccgttcttcggctacaacttcggacagtatctctctcactggctgagc
atggccgaccgccccggcgccatactccccaagatcttccacgtcaactggttccgcaag
agcccgaccgccggcttcctgtggcccggcttcggcgacaacatccgcgttctggactgg
atgttcaggcgggtgaacggcgaagccggcgccatgccctccgccgtgggatacctgccg
tgcggcgactccctgaacctccagggtctgcgggaacacgtggacctggaccagctgttc
tccctggaccaggagttctggcagagggaggtggaggaggtgaggaagtacttcaccacg
caggtgaacgacgacctgcccaacgagatggcacggcagctggacctcctgcagcagagg
gtgaagcagatgtag

DBGET integrated database retrieval system