KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111649676
Entry
111649676         CDS       T06058                                 

Definition
(RefSeq) uncharacterized protein LOC111649676 isoform X1
  KO
K05231  agouti related protein
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:slal00001]
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    111649676
SSDB
Motif
Pfam: Agouti
Other DBs
NCBI-GeneID: 111649676
NCBI-ProteinID: XP_023255161
LinkDB
Position
Unknown
AA seq 176 aa
MFVSVLLCCCSFSLLHLSSSLVHGNIPLDEGPAAGRHTETSYLSDMERGHAPDRVHDPTL
LPVDSVEDRFLMDTGSYDEVGVTDLKRQYTLQSSDVGVVNLLCGDCSECTCFQDSSAALQ
LQGRAMRSPRRCIPHQQSCLGYPLPCCDPCDTCYCRFFNAICYCRRVGHACPPRRT
NT seq 531 nt   +upstreamnt  +downstreamnt
atgtttgtctctgtgctgctctgctgttgctccttcagtctgctgcatctctcctcctct
ctggttcatggaaacatcccgctggatgagggtccggcggccggccgacacactgagacc
tcctacctttctgacatggagagaggccacgcccctgaccgcgtacacgaccccaccctc
ctacccgtcgactcagtggaggatcgcttcctgatggacacggggtcctatgacgaggtg
ggtgtgactgatttaaagagacagtacacattacagagctcagatgttggagtggttaac
ctgttgtgtggtgactgcagtgaatgtacctgtttccaggactcgtcagcagccctgcag
ctgcagggtcgggccatgcgctcccctcgtcgctgcatccctcaccagcagtcatgtctg
ggttacccgctgccctgctgcgacccctgcgacacctgctactgtcgcttcttcaacgct
atctgctactgtcgcagagtcggtcatgcctgcccacccagacgaacctga

KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111652978
Entry
111652978         CDS       T06058                                 

Definition
(RefSeq) uncharacterized protein LOC111652978 isoform X1
  KO
K05231  agouti related protein
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:slal00001]
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    111652978
SSDB
Motif
Pfam: Agouti
Other DBs
NCBI-GeneID: 111652978
NCBI-ProteinID: XP_023259176
LinkDB
Position
Unknown
AA seq 176 aa
MFVSVLLCCCSFSLLHLSSSLVHGNIPLDEGPAAGRHTETSYLSDMERGHAPDRVHDPTL
LPVDSVEDRFLMDTGSYDEVGVTDLKRQYTLQSSDVGVVNLLCGDCSECTCFQDSSAALQ
LQGRAMRSPRRCIPHQQSCLGYPLPCCDPCDTCYCRFFNAICYCRRVGHACPPRRT
NT seq 531 nt   +upstreamnt  +downstreamnt
atgtttgtctctgtgctgctctgctgttgctccttcagtctgctgcatctctcctcctct
ctggttcatggaaacatcccgctggatgagggtccggcggccggccgacacactgagacc
tcctacctttctgacatggagagaggccacgcccctgaccgcgtacacgaccccaccctc
ctacccgtcgactcagtggaggatcgcttcctgatggacacggggtcctatgacgaggtg
ggtgtgactgatttaaagagacagtacacattacagagctcagatgttggagtggttaac
ctgttgtgtggtgactgcagtgaatgtacctgtttccaggactcgtcagcagccctgcag
ctgcagggtcgggccatgcgctcccctcgtcgctgcatccctcaccagcagtcatgtctg
ggttacccgctgccctgctgcgacccctgcgacacctgctactgtcgcttcttcaacgct
atctgctactgtcgcagagtcggtcatgcctgcccacccagacgaacctga

KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111661274
Entry
111661274         CDS       T06058                                 

Definition
(RefSeq) agouti-related protein-like
  KO
K05231  agouti related protein
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:slal00001]
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    111661274
SSDB
Motif
Pfam: Agouti
Other DBs
NCBI-GeneID: 111661274
NCBI-ProteinID: XP_023270558
LinkDB
Position
Unknown
AA seq 148 aa
MTATIVREAQASPPAVSRARHVGAARFGLCDLIIMITGKHLLCFFLLVFPLSWAEDTKKD
VRRTDNDTVWSQAKTRPLFARRKISPSQESHIPKHKTDLMSPARRCGRLMENCSSRVPCC
DPCASCRCRLFNTICHCWRMNHLCLKKT
NT seq 447 nt   +upstreamnt  +downstreamnt
atgacggcaaccatcgttcgcgaagcacaagcatcacctcctgccgtgtctcgcgcccgt
catgtgggggcggcgcgtttcggtctttgtgatctcatcattatgatcactggcaaacac
ttactgtgcttcttcctgctcgtcttcccgctgtcctgggcagaggacacaaagaaagat
gtgaggaggactgacaatgatacagtttggagccaagcaaagaccagaccgctatttgca
cggcgaaagatttctccatcacaggaaagtcacattcctaaacacaagacagatcttatg
agtcctgcgcgtcgctgcggccgcctgatggagaactgctcctctcgcgtgccgtgctgc
gacccctgcgcctcctgccgctgtcggctcttcaacaccatttgtcattgctggaggatg
aaccacctgtgcttaaagaagacataa

KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111666577
Entry
111666577         CDS       T06058                                 

Definition
(RefSeq) uncharacterized protein LOC111666577 isoform X1
  KO
K05231  agouti related protein
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:slal00001]
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    111666577
SSDB
Motif
Pfam: Agouti
Other DBs
NCBI-GeneID: 111666577
NCBI-ProteinID: XP_023277721
LinkDB
Position
Unknown
AA seq 176 aa
MFVSVLLCCCSFSLLHLSSSLVHGNIPLDEGPAAGRHTETSYLSDMERGHAPDRVHDPTL
LPVDSVEDRFLMDTGSYDEVGVTDLKRQYTLQSSDVGVVNLLCGDCSECTCFQDSSAALQ
LQGRAMRSPRRCIPHQQSCLGYPLPCCDPCDTCYCRFFNAICYCRRVGHACPPRRT
NT seq 531 nt   +upstreamnt  +downstreamnt
atgtttgtctctgtgctgctctgctgttgctccttcagtctgctgcatctctcctcctct
ctggttcatggaaacatcccgctggatgagggtccggcggccggccgacacactgagacc
tcctacctttctgacatggagagaggccacgcccctgaccgcgtacacgaccccaccctc
ctacccgtcgactcagtggaggatcgcttcctgatggacacggggtcctatgacgaggtg
ggtgtgactgatttaaagagacagtacacattacagagctcagatgttggagtggttaac
ctgttgtgtggtgactgcagtgaatgtacctgtttccaggactcgtcagcagccctgcag
ctgcagggtcgggccatgcgctcccctcgtcgctgcatccctcaccagcagtcatgtctg
ggttacccgctgccctgctgcgacccctgcgacacctgctactgtcgcttcttcaacgct
atctgctactgtcgcagagtcggtcatgcctgcccacccagacgaacctga

KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111667241
Entry
111667241         CDS       T06058                                 

Definition
(RefSeq) uncharacterized protein LOC111667241 isoform X1
  KO
K05231  agouti related protein
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:slal00001]
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    111667241
SSDB
Motif
Pfam: Agouti
Other DBs
NCBI-GeneID: 111667241
NCBI-ProteinID: XP_023278650
LinkDB
Position
Unknown
AA seq 176 aa
MFVSVLLCCCSFSLLHLSSSLVHGNIPLDEGPAAGRHTETSYLSDMERGHAPDRVHDPTL
LPVDSVEDRFLMDTGSYDEVGVTDLKRQYTLQSSDVGVVNLLCGDCSECTCFQDSSAALQ
LQGRAMRSPRRCIPHQQSCLGYPLPCCDPCDTCYCRFFNAICYCRRVGHACPPRRT
NT seq 531 nt   +upstreamnt  +downstreamnt
atgtttgtctctgtgctgctctgctgttgctccttcagtctgctgcatctctcctcctct
ctggttcatggaaacatcccgctggatgagggtccggcggccggccgacacactgagacc
tcctacctttctgacatggagagaggccacgcccctgaccgcgtacacgaccccaccctc
ctacccgtcgactcagtggaggatcgcttcctgatggacacggggtcctatgacgaggtg
ggtgtgactgatttaaagagacagtacacattacagagctcagatgttggagtggttaac
ctgttgtgtggtgactgcagtgaatgtacctgtttccaggactcgtcagcagccctgcag
ctgcagggtcgggccatgcgctcccctcgtcgctgcatccctcaccagcagtcatgtctg
ggttacccgctgccctgctgcgacccctgcgacacctgctactgtcgcttcttcaacgct
atctgctactgtcgcagagtcggtcatgcctgcccacccagacgaacctga

DBGET integrated database retrieval system