KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111650370
Entry
111650370         CDS       T06058                                 

Gene name
cdkn1b
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal04012  ErbB signaling pathway
slal04068  FoxO signaling pathway
slal04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:slal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    111650370 (cdkn1b)
   04068 FoxO signaling pathway
    111650370 (cdkn1b)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    111650370 (cdkn1b)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 111650370
NCBI-ProteinID: XP_023256018
LinkDB
Position
Unknown
AA seq 185 aa
MSDVRLSNGSPTLERTDPRVSDHPKPSACRSLFGFVDHEELKKDLKGHLREMEETASAKW
GFDFANHTPLANDRLQWELVDRRDVPDFYHRPHRREKGVCSAGNNNVDLNGNHNCVVVAP
SDDTDRSEAQMECTEQCTGLRKRPARHDPSAQNKRSHTSSDEVSCPSLSHSAEHTPRKTS
PKRQT
NT seq 558 nt   +upstreamnt  +downstreamnt
atgtcagatgttcgactttcaaacgggagcccgacgctggagcggacggacccccgtgtg
tcggatcacccgaaaccgtcagcttgcaggagcctcttcggcttcgtggatcacgaagag
ttaaagaaggatttaaagggacatttgcgggagatggaagagactgcctccgccaagtgg
ggcttcgacttcgccaatcacacgccgctggccaacgacaggctccagtgggaattagtg
gatcgcagagacgtcccggatttctaccaccggccgcaccggagggagaagggcgtctgc
tccgctgggaataacaatgtggatctaaatgggaatcataactgtgttgtggtagctccg
agcgatgacaccgacaggtctgaggcgcagatggagtgcacggagcagtgcaccgggctg
aggaaaagacctgcacgtcacgacccctcggcccaaaataagaggtcacacaccagctca
gatgaggttagttgtccaagtctgagccactctgcagaacacacacccagaaagaccagc
cccaagagacaaacgtga

DBGET integrated database retrieval system