KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111650434
Entry
111650434         CDS       T06058                                 

Definition
(RefSeq) peroxisome proliferator-activated receptor alpha-like
  KO
K07294  peroxisome proliferator-activated receptor alpha
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal03320  PPAR signaling pathway
slal04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:slal00001]
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    111650434
   03320 PPAR signaling pathway
    111650434
Transcription factors [BR:slal03000]
 Eukaryotic type
  Zinc finger
   Cys4 thyroid hormone receptor-like
    111650434
Nuclear receptors [BR:slal03310]
 1. Thyroid hormone like
  1C. Peroxisome proliferator-activated receptor (PPAR)
   111650434
SSDB
Motif
Pfam: zf-C4 Hormone_recep
Other DBs
NCBI-GeneID: 111650434
NCBI-ProteinID: XP_023256100
LinkDB
Position
Unknown
AA seq 469 aa
MVDMESHYHPPSPLEDTLLDSPLCADDDFMGGMEELQDISQSIDNDALSSFDVPEYQSSS
NGSEGSTVLDALTPASSPSSVVYGLAAGQEEFSSSSSSLNLECRVCADRASGYHYGVHAC
EGCKGFFRRTIRLKLEYDKCERRCKIQKKNRNKCQYCRFQKCLSVGMSHNAIRFGRMPQS
EKLKLKAEMVTGDREVEDPQIADQKTLARQIYEAYLKNFNMNKAKARTILTGKTSTPPFV
IHDMETLQLAEQTLVAKMVGSAGVLKDREAEVRIFHCCQCTSVETVTELTEFAKSVPGFS
SLDLNDQVTLLKYGVYEALFAMLASSMNKDGLLVAYGSGFITREFLKSLRRPFSDMMEPK
FQFAMKFNALELDDSDLALFVAAIICCGDRPGLVNVAHIERMQESIVQVLQLHLLANHPD
DVFLFPKLLQKLADLRQLVTEHAQLVQEIKKTEDTSLHPLLQEIYRDMY
NT seq 1410 nt   +upstreamnt  +downstreamnt
atggtcgacatggagagccactaccatcccccttctcccctggaggacacgttgctggac
agccccctgtgcgccgatgacgacttcatgggcggcatggaggagctccaggacatctcc
cagtccatcgacaacgatgccctcagctctttcgatgtccctgaataccagtcgtccagc
aatggctccgaaggttccactgtcctagatgccctgacgccagcatccagcccctcatca
gtcgtttacgggctggcggccggccaggaggagttctcatcttcctcctcatcgctcaat
cttgagtgtcgagtgtgtgctgaccgcgcctcgggctaccactacggagtccacgcctgc
gagggctgcaagggttttttccggcggaccatccgtctgaagctggagtacgacaagtgc
gagcgccgctgcaagatccaaaagaagaaccgcaacaagtgccaatactgccgcttccag
aagtgcctgtcagtgggcatgtcccacaacgccatccgttttggtcggatgccccagtcg
gagaagctaaagttgaaggcggagatggtgacgggggacagggaggtggaagaccctcag
atagccgaccagaagacgctggccaggcagatttacgaggcctacctcaagaacttcaac
atgaacaaggccaaggctcgaaccattctcactggcaagaccagcacccctcctttcgtc
atccacgacatggagaccctccagctggcagagcagacgctggtggccaagatggtcggc
tctgcgggagtgctgaaggacagggaggcagaggttcggattttccactgctgccagtgc
acatcggtggaaaccgtcacggagctcacagagtttgcaaagtccgtccccgggttctcg
agcctggacctcaacgatcaggtgactcttttgaaatatggagtgtacgaggctctcttc
gccatgctcgcctccagtatgaacaaggacgggctccttgtagcgtacggctcgggcttc
atcacccgggaattcctcaagagcctgcggcgtcccttcagtgatatgatggagccaaag
ttccagtttgccatgaagtttaacgcgctagagctggacgacagtgacctggctctgttt
gtggccgccatcatctgctgtggagaccgaccaggcctggtgaatgtggcgcacatcgag
cgaatgcaggagagcattgtgcaggtgctacagctccatctgctggccaatcatccagac
gacgttttcctcttccccaagctgctgcagaaactggctgacctccggcagctagtcacc
gagcacgcacagctggtgcaggagatcaaaaagacagaggacacgtcgctgcacccgctc
ctgcaggagatctacagagacatgtactga

KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111651966
Entry
111651966         CDS       T06058                                 

Gene name
ppara
Definition
(RefSeq) peroxisome proliferator-activated receptor alpha isoform X1
  KO
K07294  peroxisome proliferator-activated receptor alpha
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal03320  PPAR signaling pathway
slal04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:slal00001]
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    111651966 (ppara)
   03320 PPAR signaling pathway
    111651966 (ppara)
Transcription factors [BR:slal03000]
 Eukaryotic type
  Zinc finger
   Cys4 thyroid hormone receptor-like
    111651966 (ppara)
Nuclear receptors [BR:slal03310]
 1. Thyroid hormone like
  1C. Peroxisome proliferator-activated receptor (PPAR)
   111651966 (ppara)
SSDB
Motif
Pfam: zf-C4 Hormone_recep
Other DBs
NCBI-GeneID: 111651966
NCBI-ProteinID: XP_023257801
LinkDB
Position
Unknown
AA seq 475 aa
MAGDLYSPPSPLGDSLLDSPLCGDLMDDLCDISQSIGEDTLRFDFPEYQSTCSGSESSIS
LDTLTPASSPLSGVCGTAAGPEEGLHLECRVCSDKASGFHYGVHACEGCKGFFRRTIRLK
LEYDKCERNCKIQKKNRNKCQFCRFHKCLSVGMSHNAIRFGRMPQAEKLKLKAESKMVEK
EVESPMLASHKTLVKQIHEAYMKNFSMNKAKSRLILTGKTSKPQPFIIHDMETFQLAEKT
LAVHMVNSDSLEHESGLQAGDVVPGVGCGELQQMEAEARLFHCCQSTSVETVTELTEFAK
AVPGFQSLDLNDQVTLLKYGVYEALFTLLASCMNKDGLLVARGGGFITREFLKSLRRPFS
DMMEPKFQFATRFNSLELDDSDLALFVAAIICCGDRPGLVDVPLVEQLQEGIVQALRLHL
LANHPDDTFLFPRLLQKLADLRELVTEHAQLVQEIKTTEDTSLHPLLQEIYRDMY
NT seq 1428 nt   +upstreamnt  +downstreamnt
atggcaggggacctctacagccccccatccccactgggggactcccttctggacagtccc
ctgtgcggagacctgatggacgacctttgtgacatctcccagtctataggagaagacacg
ctcagatttgatttcccagagtaccagagcacctgctcagggtcggagagctccatttca
ctggacaccttgaccccagcctccagtccgttgtcgggggtgtgtggcactgcagcaggc
cccgaggagggccttcatctggagtgccgggtgtgttcagacaaggcttcaggcttccac
tacggggtgcacgcgtgtgagggctgcaagggtttcttcaggaggaccatcaggttgaag
ctggagtacgataagtgtgaacgcaactgcaaaatccaaaagaagaatcgcaacaaatgc
cagttctgccgattccacaagtgcctctctgtgggcatgtcccacaacgccatccggttt
ggtcggatgccccaggcggagaagctgaagctaaaggctgaaagcaagatggtggagaaa
gaagtggaaagccccatgctggccagccacaagactctggtcaagcagatccacgaggct
tacatgaagaacttcagcatgaacaaggcgaaatcaaggctcatactcactggaaaaacc
agcaagccgcagcctttcatcattcacgacatggagaccttccagctagcggagaagacg
ctggcggtccatatggtaaacagtgactctctggagcacgagagcggccttcaagctggg
gatgtggttccaggtgtggggtgtggggagctccagcagatggaggccgaagcgaggctc
ttccactgctgccagagcacctcggtggagacggtcacggagctgacggagttcgctaag
gcggtgccgggtttccagagcctggatctgaatgatcaggtgactctgttaaagtacggt
gtttacgaagccctcttcaccctcttggcctcctgcatgaacaaagatggcctcctcgtg
gcccgtggtggaggcttcatcacccgtgaattcctcaaaagcctccggcgtccatttagt
gacatgatggagccaaagttccagtttgccacacgcttcaactctctggagctggatgac
agtgacctggctctttttgtggctgccattatctgctgtggagaccgtccaggcctggtg
gatgtaccgctagtggagcagctgcaggaaggcatcgttcaggcactacggctccacctg
ctggccaaccaccctgacgacaccttcctctttcccagacttttgcagaaactggccgac
ctccgggagctcgtcaccgagcatgctcagttggtgcaggaaatcaagacaacagaggac
acgtcgctgcaccctctcctgcaagagatatatagggacatgtactga

DBGET integrated database retrieval system