KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111650698
Entry
111650698         CDS       T06058                                 

Definition
(RefSeq) cellular tumor antigen p53-like
  KO
K04451  tumor protein p53
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal04010  MAPK signaling pathway
slal04110  Cell cycle
slal04115  p53 signaling pathway
slal04137  Mitophagy - animal
slal04210  Apoptosis
slal04216  Ferroptosis
slal04218  Cellular senescence
slal04310  Wnt signaling pathway
slal05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:slal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111650698
   04310 Wnt signaling pathway
    111650698
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    111650698
  09143 Cell growth and death
   04110 Cell cycle
    111650698
   04210 Apoptosis
    111650698
   04216 Ferroptosis
    111650698
   04115 p53 signaling pathway
    111650698
   04218 Cellular senescence
    111650698
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    111650698
Transcription factors [BR:slal03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   p53
    111650698
Chromosome and associated proteins [BR:slal03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     111650698
DNA repair and recombination proteins [BR:slal03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    111650698
SSDB
Motif
Pfam: P53 P53_tetramer P53_TAD SpoIIP
Other DBs
NCBI-GeneID: 111650698
NCBI-ProteinID: XP_023256390
LinkDB
Position
Unknown
AA seq 377 aa
MEEQSLDSLHLSQNLPLSQDSFRELWESVVTPSISTIPAATSVSEWRPDGQMYMLQLPEV
LTEGFDENLFELPPETLTKDGVNPPASTVPVTTDYPGEYGFQLRFQKSGTAKSVTSTFSE
LLNKLYCQLAKTTPVEVLVSKELPQGAVLRATAVYKKTEHVADVVRRCPHHQNEDTAEHR
SHLIRVEGSQRAQYFEDPHTKRQSVTVPYEPPQLGSEMTTILLSFMCNSSCMGGMNRRPI
LTILTLESPEGLVLGRRCFEVRVCACPGRDRKTEEDNSTKAQNGTKQTKKRKSTPAPDST
SVKKSKSASSAEEEDKDVYVLRVHGRERYEMLKKINDGLELLDKESKTKSKVSVKHEVPL
PSSGKRLLQRGERSDSD
NT seq 1134 nt   +upstreamnt  +downstreamnt
atggaagagcagagcctcgacagtctccacctgagccagaacctgcctctgagccaggat
tcatttcgtgagctgtgggagagtgtcgttactccctccatttccaccatcccagcggca
acaagcgtgtctgagtggaggcccgatggacaaatgtacatgctgcagttacctgaagtg
ctgactgaagggtttgatgagaatctgtttgagctacccccagagacattaactaaagat
ggtgttaatcccccggcctccaccgtcccagttacaactgactatcctggggaatatgga
tttcagcttcgctttcagaagtctggcacagccaaatccgtcacttccactttttcggag
cttctcaacaagctctactgccagctggcaaaaaccacccctgtggaagtgctggtgagc
aaggagcttcctcagggtgctgtcctcagggccacagcagtttataagaagacggagcat
gtggctgatgtggttcgcagatgtccacatcaccagaatgaagatactgcagagcatcgc
agccatctgatcagagtggaaggcagccagagagctcagtattttgaagatccacacaca
aagaggcagagtgtgacggtcccttatgagcccccccagttgggttcagagatgacaacc
atcctgctgagcttcatgtgcaacagctcctgcatgggcggcatgaaccgcaggcctatc
ctcaccatcctgaccctcgagtctccagagggactggtgctcggccggagatgcttcgag
gtgcgtgtctgcgcatgtccaggcagggaccgcaaaacagaggaggacaacagcaccaag
gcgcagaacggcaccaagcaaaccaaaaaacgaaagagcactcctgcccctgactcgact
tctgtgaagaagtccaagtctgcctccagtgcagaggaggaagacaaggatgtctatgtt
ctgcgtgttcatggtcgtgagcgttatgaaatgctaaagaaaatcaacgatggcctggag
ctgcttgacaaagaaagcaaaaccaagtccaaggtctctgtgaaacatgaggtccctctg
ccctccagcggaaagagactcctgcagagaggagagcggagcgacagtgactga

DBGET integrated database retrieval system