KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111651535
Entry
111651535         CDS       T06058                                 

Definition
(RefSeq) tyrosine-protein kinase JAK2-like
  KO
K04447  Janus kinase 2 [EC:2.7.10.2]
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal04217  Necroptosis
slal04920  Adipocytokine signaling pathway
slal05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:slal00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    111651535
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    111651535
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    111651535
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:slal01001]
    111651535
Enzymes [BR:slal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     111651535
Protein kinases [BR:slal01001]
 Non-receptor tyrosine kinases
  JAK family [OT]
   111651535
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase FERM_F2 FERM_F1 Jak1_Phl SH2 Kdo RIO1
Other DBs
NCBI-GeneID: 111651535
NCBI-ProteinID: XP_023257271
LinkDB
Position
Unknown
AA seq 1133 aa
MACILLTDMDPPTSGPTAHHNGLCPDLDTAAGCDPKQDIDATCLTVHIYYLGKDGGRGRA
KGSESVLTFPPGEYVAEELCITAAKACGIAPVYCNLFGLMRESDRIWFPPNHIFKLCQSA
CENLHFRIRYYFPGWYNNSSSFYAHRYGVSKGMESPVMDDCVMAYQFFQWRSDFLNGWVQ
TPVSHESQEECLGMAVLDMMRLAKENGQSPVDIYNDTSYKSFLPRCMQSRIQEYNILTRK
RIRYRFRRFIQQFSECKATVCNLKLKYLMSLEMLLPSLYSERFQVTDLSAREVTIVVMGN
KGIQWSKGKEEEGAEEELQTYCDFPDVIDISIKQANKEGSAESRIVTLTRQNSQILELEF
HSLSEALSFVSLVDGYYRLVADAHHYLCKEVAPPRLLECIQSYYHGPVSMDFTIGKLRRS
GNHQGLYILRCSPRDYDKYFMSFVVGYETMVDYKHCQIMKTESGEYILSGAKRSFGSLRE
LLHCYQKEALRSDGYTFQLTKCCPPSPKDKSNLLVCRNNQGAEVPLSPSLHKHISQMVFH
KIRKEDLIINESLGQGTFTKIFCGVRKELGDYGEIHQIDVVIKILDKAHRNYSESFFEAA
SMMSQLSYKHLLLNYGVCVCGDENMMVQEYGKFGSLDTYLKKNKSCVNITWKLEVAKQLA
WAMHYLENKNLVHGNVCAKNVLLIREEDRKTGSLPFIKLSDPGISITVLPREVLVERIPW
VPPECIENPQNLSLATDKWGFGTTLWEICSGGDKPLSTLDCSKKNLFYEDRHQLPAPKWT
ELANLIYNCMNYEPSHRPSFKAIIRDLKSLFTPDYDLLVESDMVPNRTRGLGFPWASENQ
EPAQFEERHLIFLKQLGKGNFGSVEMCRYDPLQDSTGEVVAVKKLQHSTAEHLRDFEREI
EILKSLQHENIVKYKGVCYSAGRRNLRLIMEYLPYGSLRDYLMKHKDHFDSKKLLHYASQ
ICKGMDYLATKRYIHRDLATRNILVESEMRVKIGDFGLTKVLPQDKEYYTVREPGESPIF
WYAPESLTESKFSVASDVWSFGVVLYELFTYSDKNWSPPAVFMDKMGNEKQGQMIVYHLI
DLLKQGYRLPAPDNCPKEIHKIMTECWSGDLKLRPTFKTLIHSVETIRDSKDG
NT seq 3402 nt   +upstreamnt  +downstreamnt
atggcctgtattctgctgacagacatggacccgcccacctctggtcccacagcacatcac
aatggcctctgccctgacctcgacacagctgccggatgtgaccccaagcaggacattgat
gcaacctgcctcactgtccacatttactacctggggaaggatggaggaaggggtagggcc
aaaggttcagaaagtgtgctcacgtttccacctggggaatacgtagcagaggaactgtgc
atcactgcagcgaaagcttgtgggattgctccagtgtactgcaacttgtttggcctgatg
agggaaagtgaccggatatggttccctcctaatcacatctttaaactctgccagtcagca
tgtgagaacctgcacttcagaatcaggtactattttcctggctggtataacaacagcagt
tcattctatgcccatcgctatggtgtatctaaggggatggagagccctgtgatggatgat
tgtgtaatggcataccagttttttcagtggcgtagtgactttcttaatggctgggttcaa
accccggtgagccacgagtcccaggaggagtgtctgggcatggcggtactggacatgatg
aggcttgctaaagagaatggtcagtcacctgttgacatctacaatgataccagctacaaa
tccttcctgccgagatgcatgcagagccgcatccaagaatataacatcttgactcggaag
aggatccgctatcgcttcaggaggtttatccagcagttcagtgaatgcaaggccaccgtg
tgtaacctcaagctcaaatacctaatgagcctggagatgctgctgccctctctctactct
gagcgcttccaagtcaccgacctctcggcacgcgaggttaccatcgttgtcatgggcaac
aagggcatccagtggtcaaaagggaaagaggaagagggagcagaggaggagctacagaca
tactgtgacttccctgacgtcattgatatcagcatcaagcaggccaataaagaaggctct
gcggagagtcgcatagttaccctcaccagacagaacagccagatcctggaactggagttt
cattccctatcagaggctctgtcattcgtatcattagttgatggatattacagacttgtc
gccgatgcccatcattacctgtgtaaagaagtggctccaccaagacttctggagtgcatt
cagagctattaccatggccctgtgtcgatggacttcacgattggtaagctgcgtcgctct
ggtaaccaccaaggcctgtacatccttcgctgcagcccaagggactacgacaaatacttc
atgtcctttgtagtggggtatgaaactatggtggactacaagcactgtcagatcatgaag
acggagtcaggagagtacattctgagtggagctaagaggagcttcggctcactgagggaa
cttctgcactgctatcaaaaggaggcgctgcgctcagatggatacacatttcagctgacc
aagtgctgcccacccagccccaaagataaatccaacctgctggtgtgtagaaataatcaa
ggggcagaggttcctctttccccctccctacacaaacatatcagtcagatggtcttccac
aagatccggaaagaggacctcatcatcaatgagagtctgggtcaaggaactttcaccaaa
atcttctgtggtgtgaggaaagagctgggagactacggagagatacatcagatagatgtc
gttatcaagatcctggacaaggctcaccgcaattattcagagtcattctttgaagcagcc
agcatgatgagccagctctcctacaagcacttactcctcaactatggtgtgtgtgtttgt
ggcgacgagaacatgatggtgcaggagtatggtaagtttggttctctggacacctatctg
aaaaagaacaaaagctgtgtcaacatcacatggaagctagaagtggccaagcagctggcc
tgggcaatgcactatctggagaataagaaccttgttcatggaaatgtctgcgccaagaat
gttcttctgatcagagaggaggatcggaaaactggcagcctgccctttatcaagctcagt
gaccctgggatcagcatcactgtgctgcccagagaagtactggtggagcgtatcccttgg
gtgccccctgagtgcattgaaaatccccaaaacctaagtttagccacggacaagtggggt
ttcgggactaccctgtgggagatctgcagtgggggagacaaaccactcagcaccctggac
tgctccaagaagaacttgttctacgaggacaggcaccagctgccagctcccaaatggaca
gagctggccaatctgatatacaactgtatgaattacgagccttcacaccgaccatctttc
aaagcaattatcagagatctcaagagcctcttcacaccagactatgacctgctggtggaa
agcgacatggtgcccaacaggacaagaggcctcggtttcccatgggcctccgaaaaccag
gagcctgcccagtttgaggagaggcatctcatctttctcaagcagctgggcaaaggaaac
tttggcagcgtggagatgtgcaggtacgaccccctgcaggacagcacaggggaggtggtg
gcggtgaagaaactacagcatagcacagccgagcacctcagggactttgagcgggaaatt
gaaatcctcaaatctctccagcatgaaaacattgtcaaatacaaaggtgtctgctacagt
gcaggacgaaggaaccttcgcttgatcatggaatatctcccctacggcagcttgagagat
tatctcatgaaacacaaggaccactttgattccaagaaactgctgcactacgcatcacag
atttgcaagggtatggactaccttgccacaaagcgttacatccacagagacctggccact
agaaacattctggtggagagtgagatgagggtgaagatcggagatttcggcctgaccaaa
gtgctgccgcaggacaaagagtactacactgtcagagagcctggggaaagtcccatcttt
tggtatgctccagagtcactgacagagagcaagttctctgtggcatcagatgtttggagt
ttcggcgtagtcctctacgaactcttcacttacagtgacaagaactggagccccccagcg
gtgtttatggacaagatgggaaatgagaagcagggccagatgattgtctaccatctgata
gacctgctgaaacaaggatacaggttgcctgctcctgataattgtccaaaggagattcac
aagattatgacagagtgctggagcggtgacctgaaactgcggcctactttcaagacatta
atccacagtgtggagacaatacgagacagcaaggacggatga

KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111665981
Entry
111665981         CDS       T06058                                 

Gene name
jak2
Definition
(RefSeq) tyrosine-protein kinase JAK2
  KO
K04447  Janus kinase 2 [EC:2.7.10.2]
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal04217  Necroptosis
slal04920  Adipocytokine signaling pathway
slal05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:slal00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    111665981 (jak2)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    111665981 (jak2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    111665981 (jak2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:slal01001]
    111665981 (jak2)
Enzymes [BR:slal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     111665981 (jak2)
Protein kinases [BR:slal01001]
 Non-receptor tyrosine kinases
  JAK family [OT]
   111665981 (jak2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase FERM_F2 FERM_F1 Jak1_Phl Kdo RIO1 Kinase-like
Other DBs
NCBI-GeneID: 111665981
NCBI-ProteinID: XP_023276916
LinkDB
Position
Unknown
AA seq 1114 aa
MDTVTDTCPAVHQNGNAHREFPDTRPAAAVLRLHFYHSSQGAADCSLLSYPPGDYVAEEL
CIDAAKACSISPLYCSLFGLFRERDCLWFSPNHIFQLDESASEDVFFRIRYYFPGWFSGG
ASRAYRYGVAKGSESPVLDDFVMSYLFSQWRNDFVNGLVKIPNSHETQEECLGMAVLDMT
RTAKERQMSPLDIYHTISYKSFLPKDMRAQIQDRNFLTRKRIRFRFKRFIQQFSQCRTTA
RDLKLKYLISMESLEKAFYTETFQVREPSSGQLIILVAADTGIQWCREKLKDSDQELQTL
CDFPDVTDISIKQASKEGAAESRVVTINKQDGKNLELEFPSLSEALSFVSLVDGYYRLTT
DAHHYLCKEVAPPRLVEAISSHCHGPISMEFAINQLQKCGNKRGLYILRCSPKDFNKYFL
TFPVEVYDTVEYKHCQITRSASGEFNLSGAKRNFSSLQELLSCYQKETVRSDSVIFQFSK
CCPPKAKEKSCLLVCRCNKGSEVPLSPSLHRHNISQMVFHKIRKEDLEFMESLGQGTFTK
IFKGVRKELGDYGLVHHTEAVMKVLDHAHRNYSESFFEAASMMSQLSHKHLILNYGVCVC
GEENIMVQEYVKFGSLDTYLKKNKNSINILWKLEVAKQLAWAMNFMEEKHLVHGNVCAKN
VLLIREEDRRAGNPPFIKLSDPGISITVLPKEILIERIPWVSPECIEDPANLSLAADKWS
FGTTLWEICSGGEKPLSTLDNSKKTLFYEDRHQLPAPKWTELANLITSCMDYEPTFRPTF
RAIIRDLHSLFTPDYELIVDSDILPNRTVGSAWSTGGFENQEPAQFEERHLIFLQQLGKG
NFGSVEMCRYDPLQDNTGEVVAVKKLQHSTAEHIRDFEREIEILKSLQHENIVKYKGVCY
SAGRRNLRLIMEYLPFGSLRDYLMKNKERIDHKKLVHYTSQICKGMEYLSSKRYIHRDLA
TRNILVESELRVKIGDFGLTKVLPQDKEYYMVKEPGESPIFWYAPESLTESKFSVASDVW
SFGVVLYELFTHSDKICSPPAVFMSMMGNDKQGQLIVYHLIELLKSGSRLPQPLGCPSEI
HEVMEECWDNDPSLRPSFKELALRIDLFRDSKEF
NT seq 3345 nt   +upstreamnt  +downstreamnt
atggacactgtgacagacacatgccccgcggtgcatcaaaatggaaatgcccatcgggag
tttccagacacaagaccagccgctgctgttctgaggcttcatttctaccacagcagccag
ggagcagctgactgcagcttactcagctacccacctggggactatgtggctgaagagctg
tgtatagatgcagccaaggcgtgcagtatatcacctctgtactgcagcctttttggtctc
ttcagagagcgagattgcttgtggttttcaccaaaccacatcttccagcttgatgaatcg
gcttcagaagatgtgtttttcagaataaggtactacttccctggctggttcagtggtggg
gcatcgcgggcataccgatatggcgtcgccaaggggtcagaaagccctgtcctcgatgac
tttgtaatgtcatacctcttctctcagtggaggaatgactttgtgaatggcttggtgaag
atccccaactcccatgagactcaggaagagtgcctcggtatggctgtactcgacatgaca
aggacagccaaggaaagacagatgtcgccactggacatctaccacactataagctacaag
tccttcttgccaaaggacatgagagctcagatccaggaccgcaacttcttgacacgaaag
cgaatccgcttccgcttcaagcgcttcatccagcagttcagtcagtgtcggaccacagcg
cgtgacctcaagcttaagtacctcattagcatggagtccctggagaaggccttctacacg
gagactttccaggtcagagaaccgtccagcgggcagctcatcatcctggtggcggcagac
actggcatccagtggtgtcgagagaagctgaaagattctgaccaggagctgcagaccctg
tgtgacttccctgatgttactgacatcagcatcaaacaggccagcaaggagggtgctgca
gagagtcgggtggtcaccatcaacaagcaagatggcaagaatctggagctggagtttccc
agtttatctgaagcgctctcctttgtgtccctcgttgacggctactatcggctgactaca
gacgcacatcactacctttgtaaagaagtggcacctccgaggcttgtggaggccatctct
tctcattgccatggcccgatttcaatggagtttgccatcaaccagcttcagaagtgtgga
aacaagcggggcctttacattttgagatgtagccctaaagacttcaacaagtattttctg
actttccctgttgaggtgtatgacactgtagaatacaagcactgccagataaccaggtct
gccagcggggagtttaacctcagtggagccaaaagaaacttcagtagcctgcaggagcta
ctcagctgctaccaaaaggaaactgtgcgctctgacagtgtcattttccagttcagcaag
tgctgtccacctaaagccaaagaaaagtcctgcctgcttgtgtgcaggtgcaacaagggc
tcagaagtgcctctatctccatcactacatcgacacaacatcagtcaaatggtgtttcac
aagatcaggaaagaagatctggaatttatggagagtcttggtcaagggacatttacaaag
atcttcaaaggggtccgcaaggagctgggagactatggactcgtgcaccacacagaagct
gtcatgaaagtgcttgatcatgcccacaggaattactctgagtctttctttgaagctgcc
agcatgatgagtcagttgtcccataagcacctgatccttaactacggcgtgtgtgtctgc
ggagaagagaacattatggtgcaggagtatgtgaagtttggctcactggatacctacttg
aagaagaacaaaaactctataaacatcctgtggaagcttgaagtggcaaagcagctggcc
tgggccatgaacttcatggaagagaagcatcttgtccacgggaacgtgtgtgctaaaaat
gttcttctgatcagagaggaggaccggagggctgggaaccccccctttatcaaacttagt
gaccctggcatcagcataactgtcctacccaaagaaatcctgattgagaggatcccttgg
gtttcccctgaatgtatcgaggaccctgccaacctcagcctggctgcagacaagtggagc
tttggcaccacgctatgggagatctgcagtggtggggagaaacctctatcaacactggac
aactctaagaaaaccctgttctacgaggaccgccatcagcttcctgcaccgaagtggacc
gaactggctaatctaattaccagctgcatggactacgagcccacattcaggccaacattt
cgggccatcatccgtgacctccacagcctcttcacaccagactatgagttgatcgttgac
agtgacatcctgccaaacaggactgtgggctccgcctggtccactgggggctttgagaat
caggagccagctcagtttgaagagagacacctcatattcttacagcagttgggcaaggga
aactttggcagcgtggagatgtgtcggtatgacccactgcaggacaacactggggaggtc
gtggctgtgaagaaactacagcacagcactgcagagcacatacgagactttgagcgcgag
atcgagatcctgaaatctctgcagcatgagaacatcgtcaagtacaaaggcgtatgctac
agtgcaggacgaagaaatctccgcctcattatggaatatctgccttttggaagtctgcga
gattacctcatgaaaaacaaggaaaggatcgatcacaagaagcttgtgcactacacttct
cagatctgcaagggtatggagtacctgtcgagtaagcggtatatccacagagacctggca
acaagaaatatcctagtggagagtgagctgagggtgaagattggagattttggcctcacc
aaagttctgcctcaggacaaagagtactacatggtcaaagagccaggagagagccccata
ttctggtatgctcctgagtcgttgactgagagcaaattctctgtggcgtcagatgtctgg
agctttggagtggtgctttatgagctcttcacccacagcgacaagatctgtagccctcct
gcagtttttatgtctatgatggggaacgacaagcagggacagttgatcgtctatcacctc
attgaactccttaaatcaggcagcaggctgcctcagcctctgggctgtccctcagagata
catgaggtcatggaggagtgctgggacaacgaccccagcctgcgtccttctttcaaggaa
cttgcccttcgcatcgacctgttcagggacagtaaggagttttaa

DBGET integrated database retrieval system