KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111651967
Entry
111651967         CDS       T06058                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B-like
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal04012  ErbB signaling pathway
slal04068  FoxO signaling pathway
slal04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:slal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    111651967
   04068 FoxO signaling pathway
    111651967
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    111651967
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 111651967
NCBI-ProteinID: XP_023257803
LinkDB
Position
Unknown
AA seq 190 aa
MCNKMSDVRLSNASPTLERGVDARQQDNLRPRVRRNLFGRPNPEEIQRNLDAVVQEEVQA
FRERYNFDPVTDRPLSPGNYEWQEDSDPPEFFLRPPHGSQRPQRDVDLPGDNQQQDAEDR
SERRSTRQPDRHGSKKRRRGALGPCSGECQSKRLHSDEDDDEDQSNGTGSQAVKAAEERP
SRPESSAEVQ
NT seq 573 nt   +upstreamnt  +downstreamnt
atgtgcaacaaaatgtcagatgttcgcctttctaatgcgagcccgacattggagaggggg
gttgatgcgcggcagcaagacaacctcagacctcgggttcgccgaaatctttttggccga
ccaaacccagaggagatacagaggaatttggatgctgtagtgcaggaagaagtgcaggct
tttagggagaggtacaatttcgacccggtgaccgacagaccgctgagtccgggtaactat
gagtggcaagaggacagcgacccaccggagttttttctcagaccgcctcacgggagccag
cggccccagcgagatgtggacttgcccggcgataaccagcagcaggacgccgaggacagg
agtgaacggcggtcgactcgccaaccagacagacacggttcaaagaaaagacgtcgagga
gctttaggtccctgctccggcgagtgtcaaagtaaaaggttgcattccgacgaagatgat
gatgaagaccagtcgaacggtacaggaagtcaggcggttaaagccgcggaggagagaccc
agcaggccggagagcagcgcggaggtccagtga

DBGET integrated database retrieval system