KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111652612
Entry
111652612         CDS       T06058                                 

Gene name
stk11
Definition
(RefSeq) serine/threonine-protein kinase STK11
  KO
K07298  serine/threonine-protein kinase 11 [EC:2.7.11.1]
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal04068  FoxO signaling pathway
slal04140  Autophagy - animal
slal04150  mTOR signaling pathway
slal04530  Tight junction
slal04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:slal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    111652612 (stk11)
   04150 mTOR signaling pathway
    111652612 (stk11)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    111652612 (stk11)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    111652612 (stk11)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    111652612 (stk11)
Enzymes [BR:slal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     111652612 (stk11)
Protein kinases [BR:slal01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   111652612 (stk11)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Pkinase_fungal APH Kdo
Other DBs
NCBI-GeneID: 111652612
NCBI-ProteinID: XP_023258700
LinkDB
Position
Unknown
AA seq 438 aa
MSTGELHHLDYLNENELMEMDTFIHRIDSTEVIYQPRRKRAKLIGKYLMGDLLGEGSYGK
VKEMLDSETLCRRAVKILKKKKLRRIPNGEANVKKEIQLLRRLQHKNVIQLVDVLYNEEK
QKMYMVMEYCVCGMQEMLDSVPEKRFPVFQAHGYFCQLLDGLEYLHSQGIVHKDIKPGNL
LLTTDGALKISDLGVAEALHPFAEDDTCRTSQGSPAFQPPEIANGLDTFSGFKVDIWSAG
VTLYNITTSLYPFEGDNIYKLFENIGKGDYTIPEECGPLLSDLLRGMLEYDPAKRFSIQN
IRQHNWVRKKHPPSELPVPIPASAESRDPWRSMTVVPYLEDLHGYTEEDDDELYDGEDEI
IYTQDFTVPGQVAEEHRDQGNADHSPAVAKPVCVNGTEGGSLNSKAKAERRSSSSSNPSR
KGVSTASKIRKLSTCKQQ
NT seq 1317 nt   +upstreamnt  +downstreamnt
atgagtaccggggagctgcatcatcttgactatctaaatgaaaatgaactgatggagatg
gatactttcattcaccgcattgactctacagaggtgatctaccagccacggagaaagagg
gcaaagctgataggaaagtacttgatgggggatctgctgggggagggatcttatggcaaa
gtgaaagagatgctggactcagagacactttgtcgcagggctgtcaagatactgaagaag
aagaagctgaggaggatccctaatggagaagccaatgtgaaaaaggagattcagctgcta
agaagactccaacacaagaatgtgattcagttggtggatgtcctctacaatgaagagaag
cagaaaatgtatatggtgatggagtattgcgtttgtgggatgcaagaaatgctggatagc
gtcccagagaaaaggtttccagtatttcaagctcacgggtacttttgccaactcttagat
ggccttgaatatttgcacagccagggaatagttcacaaagacattaaaccagggaatctg
ctgctgaccacagacggggcacttaaaatctccgacctgggagtagcagaggcccttcac
ccatttgcagaggacgacacatgtcgcaccagtcaaggctctccggctttccagcctcca
gagattgccaacggactggacaccttttcagggtttaaagtagacatttggtctgctggt
gtaacactatacaacattacaacgagtctgtatccatttgagggggacaacatctataag
ctatttgagaacattggaaaaggagactacactattcccgaggagtgtggaccccttctg
tcggacctactgcgaggaatgcttgagtacgaccctgcgaagaggttttccatacagaac
ataagacaacacaactgggtgcgtaagaaacatcctccgtctgagctccccgtgcccatc
cctgccagcgcagagagcagggacccttggcggagtatgacggtggtgccctaccttgag
gatctgcacggctacacagaggaggacgatgacgagctctatgacggagaggatgagatc
atatacactcaggacttcacagtgccaggacaagtggctgaggaacaccgggatcagggg
aacgcagaccacagtccagctgtagccaagccagtttgtgtgaacgggacagaggggggt
tctttgaacagcaaggccaaagccgaacgccgatcctcctcctcatccaacccctcacgc
aaaggagtctcgacagccagcaagatccgcaagctctccacctgcaaacagcaatga

KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111652996
Entry
111652996         CDS       T06058                                 

Definition
(RefSeq) calcium/calmodulin-dependent protein kinase kinase 2-like isoform X1
  KO
K07359  calcium/calmodulin-dependent protein kinase kinase 2 [EC:2.7.11.17]
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal04140  Autophagy - animal
slal04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:slal00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    111652996
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    111652996
Enzymes [BR:slal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     111652996
Protein kinases [BR:slal01001]
 Serine/threonine kinases: Other
  CAMKK family
   111652996
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like APH Pkinase_fungal
Other DBs
NCBI-GeneID: 111652996
NCBI-ProteinID: XP_023259194
LinkDB
Position
Unknown
AA seq 596 aa
MFPCHVTPWPSTEPPASCGSHAPSAQPSQPLPDLLCSCPAPPLNTHSETPSPDPMESLIV
VTEYEPSRPPGEAGEEEEVEEMDSSETPEPASSVATTFRTPSCDLLSHTVGRSEALLPES
QEQRGRLNLSDRKLSLQERSQSATSPCSSPGLNGRYIYPSLPYSPITSPHSSPRLPRRPT
VESHSVSITDLQDCVQLNQYKLKDEIGKGSYGVVKLAYNEDDNTYYAMKVLSKKRLMRQA
GFPRRPPPRGAKAAPEGPPHPKGPLERVYQEIAILKKLDHSNVVKLVEVLDDPSEDHLYM
VFELVKQGAVMEVPTDKPFSEDQARFYFQDLLRGIEYLHYQRIIHRDIKPSNLLVGEDGH
IKIADFGVSNQFEGADALLTSTVGTPAFLAPEALSETRKNFSGKAIDVWAMGVTLYCFAF
GVCPFMDERILSLHQKIKTQPVVLPEHADISDDLKDLLLKMLDKNPETRISVTQIKVHPW
VTRHGAEPLPLEDDNCCMLIEVTEEEVENSVKHIPSLATVILVRTMLRKRSFGNPFDWGR
KEDRSSLCAAGQTLTKGKAGNVRYCYIHCNQKRKQESGDGMRSMDLPYVGEDEALS
NT seq 1791 nt   +upstreamnt  +downstreamnt
atgtttccttgtcacgtaaccccctggccctccactgagccaccagcctcctgcggcagt
catgcaccctcagcgcagccctcacaaccccttcctgacctgctgtgcagctgtcctgct
ccacctttgaacacccactctgagacaccctccccggaccccatggagtccctcattgta
gtcacggagtacgaacccagcaggccacctggagaggctggggaggaggaggaggtagaa
gaaatggacagttctgagacgcccgagccagcttcttctgtggcgacaactttcaggact
ccttcctgcgacctgctgtcccacacagttggccgatcagaggctctgctaccagaaagc
caagagcaaaggggaagattaaacctgtcagacaggaaactatctctgcaggagcgctca
caaagtgcaacatcaccctgcagctctccaggactcaacgggcgctatatttacccatcg
ttaccctactcacccatcacatcaccccactcctctccacgcttgccccgccgacccact
gtggagtcccacagtgtttctatcacagaccttcaggactgtgttcaactcaaccagtat
aagctgaaagatgagattggaaagggctcctatggtgttgtcaagctggcttacaatgag
gatgacaacacgtactatgcgatgaaggtgttgtccaagaagaggctgatgaggcaggca
ggtttcccacggagacctccccctcgtggagccaaagcagctcctgagggtccacctcat
cctaaaggacccctggagcgggtctatcaagagattgccatcctgaaaaagctggaccat
tccaatgtagtaaaattagtggaagttttggatgaccccagcgaggaccatctgtacatg
gtgtttgagctggtcaagcaaggggctgtgatggaggtgccgacagataaacctttcagt
gaggaccaggcacgtttttacttccaggatctgctcaggggaatcgagtatttgcattac
cagaggatcatccatagagacatcaaaccctctaacctgttggtgggagaggatggacac
atcaagattgcagactttggagtcagtaaccagtttgagggagctgatgccctcctgaca
agcacagtgggaacacctgctttcctcgcccctgaagcgctctctgagaccaggaagaac
ttctctggaaaggctatagatgtttgggccatgggagtgacgctttattgcttcgccttt
ggagtgtgtccatttatggatgagcgcatcctcagtcttcatcagaaaatcaagacacaa
ccagtggtgttacctgaacatgccgacatatcagatgatctcaaagatttgttgctgaaa
atgttggacaagaatccagagaccaggatatcagtcacacagattaaggtgcacccatgg
gtgacgaggcacggggccgagcccctccccctagaggatgacaactgctgtatgctgatt
gaggtgaccgaggaggaggtggagaattcggttaaacacatccccagcctggctacagtg
attctggtgaggaccatgctgaggaaacgttccttcgggaacccctttgactggggccgt
aaagaggaccgcagcagcttgtgtgctgcagggcaaacgctcacgaaaggcaaagcaggc
aatgtgagatactgctacatacattgtaaccaaaaaaggaagcaggagagtggtgatggc
atgaggagtatggacctgccctacgtgggagaagatgaggctctttcctga

DBGET integrated database retrieval system