KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111652694
Entry
111652694         CDS       T06058                                 

Definition
(RefSeq) glucocorticoid receptor-like
  KO
K05771  glucocorticoid receptor
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:slal00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    111652694
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:slal03000]
    111652694
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:slal03310]
    111652694
Transcription factors [BR:slal03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    111652694
Nuclear receptors [BR:slal03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   111652694
SSDB
Motif
Pfam: GCR Hormone_recep zf-C4
Other DBs
NCBI-GeneID: 111652694
NCBI-ProteinID: XP_023258804
LinkDB
Position
Unknown
AA seq 778 aa
MDKGGVKKITFRRDDLLSKLVYTESPEEGGLLKVAPHSAMSITSATSVVLPSSPLMRPGQ
VPNGLSNSPLPEELTSASFTATVGPFLEDPEPRGLTKDQRPQQQQLLQTQTSITFGRQTL
GDTLPQLEASIADITQSSMDSLIGGSDPNFFPMKTEDFSMDKGDQDPIDLDHAFDHIGKD
VDVHQKLFSDNTLDLLQDFELTGSPSDFYGGDDAFLSTLADDSLLGDVGSERDIKSTLVE
SSNSNGAVSVALNGSIMTSPDQSCSSMSTTSPQTPTTTLSALVKKEKDAGFIQLCTSGVI
KQEKTSAGQSYCQISGTSSTVIPSSNPISICGVSTSGGQRYHFGVSPSSSEAQQLKDQKP
VYLPVTTISGAWNRGQGLADTSAMQRPSEAFSSSPSYPTRPEGVPATSSPQGKGGTHKIC
LVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACRYRKC
LMAGMNLEARKTKKLNRLKGNQLSNPPEVSPPPVESYSLVLPGKYQPQLVPTMLSLLKAI
EPDTIYAGYDSTLPDTSTRLMTTLNRLGGRQVISAVKWAKALPGFRNLHLDDQMTLLQCS
WLFLMSFGLGWRSYQQCNGNMLCFAPDLVINEERMKLPYMADQCEQMLKISSEFVRLQVS
HDEYLCMKVLLLLSTVPKDGLKSQAVFDEIRMSYIKELGKAIVKREENSSQNWQRFYQLT
KLLDSMHEMVGGLLSFCFYTFVNKSLSVEFPEMLAEIISNQLPKVKAGSVKPLLFHQR
NT seq 2337 nt   +upstreamnt  +downstreamnt
atggataaaggtggagtgaagaagataacatttagaagagatgaccttttaagcaaattg
gtctacactgaaagccctgaggagggaggtctgttgaaagtggctcctcacagtgccatg
tccatcacctctgccacttctgtcgttcttccatccagcccattgatgcggccaggacag
gttcctaacggcctcagcaacagcccccttccagaggagctcacctctgcctctttcact
gccaccgtaggcccctttttggaagacccagagcccaggggcctgaccaaagatcagagg
cctcagcagcagcagttactccaaacacagacatccattacgtttgggcgtcaaactttg
ggggacactttgccccagttggaggccagcatagcagacattacccagtcctccatggat
tcacttattggaggatcagatcccaatttcttccccatgaaaacagaggatttctccatg
gataaaggagaccaggatcccattgaccttgatcatgcctttgatcacattgggaaagat
gtggacgtgcaccagaagttgttcagtgacaacactctggacctgctccaagactttgag
ctcactgggtctccctcagatttttacggaggggatgatgcctttctgtccactctggca
gatgattctttgcttggggacgttggctcagagagggacataaagtctaccttggttgag
agcagtaacagcaatggggcagtctctgttgctctcaatggtagcattatgacaagtcca
gatcagtcctgctccagcatgtccacaacatccccgcaaacccctacaaccactttgtct
gcattggtgaagaaagaaaaagatgctggcttcattcagctctgcacctcaggtgtgatc
aaacaggagaagacgtctgcaggccagagttattgccaaattagtggcacgtcctccaca
gtcataccaagctctaaccccatttccatatgtggggtcagcacctctggaggacagcgg
taccactttggagtcagccccagtagcagtgaagctcaacagcttaaggatcagaagcca
gtgtatctcccagtgaccaccattagtggagcctggaacagaggccaaggtttggcggac
acctcagcgatgcagaggcccagtgaggctttctcaagctctccatcatacccaaccaga
ccagaaggagtcccagctacatcctcaccacagggaaagggcgggactcataaaatctgc
ctggtgtgctctgatgaggcttcaggctgtcactatggcgttcttacctgtggcagctgc
aaggtcttcttcaagagagcagtggaagggcagcataattacctgtgtgctgggaggaac
gactgcataatagacaagatcaggaggaagaactgccctgcctgccgctaccgcaagtgt
ctaatggcaggcatgaacctggaagcacgcaaaaccaagaagttgaaccgcttaaagggc
aaccagctgagcaacccgcccgaggtgtctcctccaccagttgagtcttactccctggta
ctccctggtaagtaccagcctcaactagtgcccacaatgctgtccctgctgaaggccatc
gagccagacaccatctacgctggctatgacagcaccctgcccgacacctccacccgcctc
atgaccaccctgaacaggctgggaggccgacaggtcatctctgctgtcaagtgggccaag
gccctgccaggtttcaggaaccttcacctggatgaccagatgaccctgctgcagtgctcc
tggctcttcctcatgtctttcggtctgggctggaggtcgtaccaacagtgcaacggcaac
atgctctgcttcgcacccgacctcgtcatcaatgaagagcgaatgaaactgccctacatg
gccgaccagtgtgagcagatgctgaagatttccagcgagtttgtccggctgcaggtttcc
catgacgagtatttgtgcatgaaggtcctgctgctgctcagcacagtgccaaaggacggc
ctgaagagccaggcggtgttcgatgaaattcggatgtcgtacatcaaggagctgggaaaa
gccatcgtgaagcgtgaagagaactccagccagaactggcagcgtttctatcagctcacc
aagctgctcgactccatgcatgagatggttggtggactgctcagcttctgcttctacacc
tttgtgaataaatccctgagtgtggagttcccagagatgctggcggagatcatcagcaac
cagttaccaaaagtcaaggccggcagcgtcaaacctctcctcttccaccagagatga

DBGET integrated database retrieval system