KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111652698
Entry
111652698         CDS       T06058                                 

Definition
(RefSeq) putative fibroblast growth factor 1
  KO
K18496  fibroblast growth factor 1
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal04010  MAPK signaling pathway
slal04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:slal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111652698
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    111652698
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:slal04052]
    111652698
   00536 Glycosaminoglycan binding proteins [BR:slal00536]
    111652698
Cytokines and growth factors [BR:slal04052]
 Growth factors
  Growth factors (RTK binding)
   111652698
Glycosaminoglycan binding proteins [BR:slal00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   111652698
SSDB
Motif
Pfam: FGF Fascin Ntox17 CDtoxinA
Other DBs
NCBI-GeneID: 111652698
NCBI-ProteinID: XP_023258807
LinkDB
Position
Unknown
AA seq 161 aa
MSGMADGEVFTVEDQAVDSARLLLRDYRRLTRLYCMNGGHHLQILPDGTVQGQRDEGDVH
TVLKIKAVDTGVVVIQGTEAGRYLAMSDEGRLYSSHTVTDECYFLEKLEENHYNTYQAQK
YQEKNWYVALKKNGKPKLGPRTHIGQKAVFFLPRQLDDCGE
NT seq 486 nt   +upstreamnt  +downstreamnt
atgagcgggatggcggatggagaagtgttcacagtggaagatcaggccgtggacagcgcc
cggctgctgctgcgggactacaggcggctgactcggctgtactgcatgaatggcggacat
cacctgcagatcctgcccgatgggacagtgcagggccagagggatgagggggacgttcac
accgttttaaagattaaagctgtggacacaggtgtggtggtgatccaaggcacagaagct
gggcgatatttggccatgagtgatgagggacgtttgtacagttcacacactgtgactgat
gaatgttacttcctggagaaactggaggagaatcactacaacacctatcaggctcagaaa
tatcaggagaagaactggtacgtagctctgaaaaagaacgggaaacctaaactgggtcca
agaacgcacatcggacagaaggccgtcttctttctgccccgacagctggacgactgcggg
gagtga

DBGET integrated database retrieval system