KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111654531
Entry
111654531         CDS       T06058                                 

Gene name
g6pc2
Definition
(RefSeq) glucose-6-phosphatase 2
  KO
K01084  glucose-6-phosphatase [EC:3.1.3.9]
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal00010  Glycolysis / Gluconeogenesis
slal00052  Galactose metabolism
slal00500  Starch and sucrose metabolism
slal01100  Metabolic pathways
slal04068  FoxO signaling pathway
slal04910  Insulin signaling pathway
slal04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:slal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    111654531 (g6pc2)
   00052 Galactose metabolism
    111654531 (g6pc2)
   00500 Starch and sucrose metabolism
    111654531 (g6pc2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    111654531 (g6pc2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    111654531 (g6pc2)
   04920 Adipocytokine signaling pathway
    111654531 (g6pc2)
Enzymes [BR:slal01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.9  glucose-6-phosphatase
     111654531 (g6pc2)
SSDB
Motif
Pfam: PAP2
Other DBs
NCBI-GeneID: 111654531
NCBI-ProteinID: XP_023261360
LinkDB
Position
Unknown
AA seq 358 aa
MDFVHSIGVLVIQHLQNNYRECHDFLSFMSAVGDPRNIFSVYFPLWFHLSHNVGTKMIWV
AVIGDWFNLIFKWILFGQRPYWWVQETHFYHNNSFPYLEQFPITCETGPGSPSGHAMGSS
SVWYVMITSALNFTRPSSSATSVQSFQRFRLLRSGLWMAFWVIQISVCISRVFIATHFPH
QVILGLLAGMLVAAVFDHIPSVYSANLKVYLQTNVFLFCIAVCFYLLLKLMDIDLLWSVT
KAKKWCANPEWIHLDTTPFAGLFRNLGALFGLGLAVNSEMFTQSCKGKNGYKTRFKLMCV
TATLTCLQLYDFIKIPTHTEVLFYILSFCKSASVPLGVVAVIPYCVHLLVGDEERKLA
NT seq 1077 nt   +upstreamnt  +downstreamnt
atggattttgtccacagcatcggggtgctggttatacagcacttgcagaacaactacagg
gaatgtcacgacttcctcagcttcatgtcagctgtgggtgaccctcgtaatattttctcc
gtttatttccctctctggttccatctcagtcacaatgttggcaccaagatgatatgggtg
gctgttattggagattggttcaatcttattttcaaatggattctttttggtcagcgacct
tactggtgggtccaagaaactcacttctaccacaacaattcattcccatatttggagcaa
tttcccatcacatgtgaaacggggccaggtagtccatctggtcatgccatgggttcatct
tctgtgtggtatgtgatgatcacctctgctctcaactttaccaggccttcctccagtgcc
acatctgtgcagagttttcaaaggtttcgtcttctgaggtctggtctgtggatggctttt
tgggtcattcagataagcgtttgcatatccagggtttttattgcaacacattttccacat
caggttatccttggtcttttagcaggaatgctggttgctgcggtgtttgatcacatcccc
tcagtctacagcgcaaacttgaaagtgtacctccagaccaatgtttttctattctgtatt
gctgtttgcttttatctgctcctcaaattgatggacattgatcttctttggtcagttact
aaagccaagaagtggtgtgctaacccagagtggatccatctcgacaccaccccttttgct
ggtctttttagaaaccttggagccttgtttggtctgggcctggcggtaaactctgagatg
ttcactcagagctgtaaggggaaaaacggctacaaaaccagatttaaactcatgtgtgtg
acagcaactctcacatgtctgcagctgtacgatttcatcaaaatacccactcacactgag
gttctgttttacatactgtcattttgtaagagcgcttcagtacctcttggtgtggttgcc
gttattccttactgtgttcatttgttggtcggagatgaggagaggaagctagcttag

KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111656130
Entry
111656130         CDS       T06058                                 

Definition
(RefSeq) glucose-6-phosphatase-like
  KO
K01084  glucose-6-phosphatase [EC:3.1.3.9]
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal00010  Glycolysis / Gluconeogenesis
slal00052  Galactose metabolism
slal00500  Starch and sucrose metabolism
slal01100  Metabolic pathways
slal04068  FoxO signaling pathway
slal04910  Insulin signaling pathway
slal04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:slal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    111656130
   00052 Galactose metabolism
    111656130
   00500 Starch and sucrose metabolism
    111656130
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    111656130
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    111656130
   04920 Adipocytokine signaling pathway
    111656130
Enzymes [BR:slal01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.9  glucose-6-phosphatase
     111656130
SSDB
Motif
Pfam: PAP2 DUF4181
Other DBs
NCBI-GeneID: 111656130
NCBI-ProteinID: XP_023263489
LinkDB
Position
Unknown
AA seq 352 aa
MDLLHSWGVELAVHLQTRYSRYEGLFSLASTVADLHTTFFWLFPIWFHLRRDTGLRLIWV
AVIGDWLNLVLKWVLFGERPYWWVHDTRFYGAHPVPSVKQFPITCETGPGSPSGHAMGAA
GVWYVMVTALLSIATEKRCPSLLYKFLQIILWTLLGLVELVVCMSRIYMAAHFPHQVIAG
VITGLLVAEVVSREKWIYSASMKRYFFTTLFLTSFAVGFYLLLKAVGVDLLWTLEKAQRW
CIKPEWVHLDSTPFASLLRNMGTLFGLGLGLHSALYTETKKKNTSVTFKMGCIIISLFLL
QLLDGWTFSSENHMTFYFLSFGKSAVALLIPTTLVPGALCGIFKEKREDKDL
NT seq 1059 nt   +upstreamnt  +downstreamnt
atggatcttctccacagctggggggttgagctggcggtccacctgcagacccgatacagc
aggtacgagggtttgttcagcctggcatccacggtggctgatctgcacaccacgttcttc
tggttgttcccgatctggttccacctgcggagggatacggggctccggctcatctgggtg
gctgtgatcggagactggctcaacctggtcctgaaatgggttctctttggggagagaccc
tactggtgggttcatgacacccggttttatggagcacatccagtcccttctgtgaagcag
ttccccatcacatgtgagactggaccaggaagtccttcaggtcatgctatgggtgcagct
ggcgtctggtatgtgatggtgacggcactactctctattgcaacagagaagcgatgtccc
tctttactatacaagttcttgcagataatcctgtggacactgctgggcctggtagagctt
gtggtctgcatgtctagaatctacatggcagcccacttcccacaccaggttatcgctgga
gtcattacaggtctactagtggctgaggttgtctccagggagaaatggatctacagcgcc
agcatgaagaggtacttcttcaccaccctcttcttgacctccttcgccgtcggcttctac
ctcctgctcaaagctgtgggcgtggacctgctgtggaccctggagaaagcccagaggtgg
tgcatcaagcccgagtgggtccatctggacagcacaccctttgccagcctcctgcgtaac
atgggcaccctttttggcctgggcctgggcctgcactcggcgctctacaccgagaccaag
aagaagaacacaagtgtcactttcaagatgggatgtataattatctctttgtttctgctt
caactgttggatggatggacattttcctctgaaaaccatatgactttctacttcctgtct
tttggaaagagtgcagttgcacttttaatcccaaccactctggtgcctggggctctctgt
gggatttttaaggaaaagagagaagacaaggacttgtga

KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111656159
Entry
111656159         CDS       T06058                                 

Gene name
g6pc3
Definition
(RefSeq) glucose-6-phosphatase 3
  KO
K01084  glucose-6-phosphatase [EC:3.1.3.9]
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal00010  Glycolysis / Gluconeogenesis
slal00052  Galactose metabolism
slal00500  Starch and sucrose metabolism
slal01100  Metabolic pathways
slal04068  FoxO signaling pathway
slal04910  Insulin signaling pathway
slal04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:slal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    111656159 (g6pc3)
   00052 Galactose metabolism
    111656159 (g6pc3)
   00500 Starch and sucrose metabolism
    111656159 (g6pc3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    111656159 (g6pc3)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    111656159 (g6pc3)
   04920 Adipocytokine signaling pathway
    111656159 (g6pc3)
Enzymes [BR:slal01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.9  glucose-6-phosphatase
     111656159 (g6pc3)
SSDB
Motif
Pfam: PAP2
Other DBs
NCBI-GeneID: 111656159
NCBI-ProteinID: XP_023263529
LinkDB
Position
Unknown
AA seq 339 aa
MEAIYTQGIWMAETLQQRTRSQEKFWLVVTHIGDPKAAFLLLFPFTYFISKRAGVAVLWV
AAISEWLNLVFKWMLFGERPFWWIGESRLFVNKQPKVHQFSSTCETGPGSPSGHAMVTAA
VWWVVVSSLGSFLYSRTHSVVLSAAPYLFYVLMLVAVGISRIFILAHFPHQVVAGSITGL
ILGIVLSRRVPEGRPLLFFFNFSIGLLLSALMLHAGLQQLGIDLSWSITLAKKWCSHSEW
IRLDTAPFSSLTRDCGALLGLGLAQYWKPGGFSLPWAPRALSLAISSMGLYHVNRLPLPI
QPQGLFYGLFFVKFVIVPQIVMVLVPGLVHLFTRKKKKD
NT seq 1020 nt   +upstreamnt  +downstreamnt
atggaggcgatttatacccaaggcatttggatggctgaaactcttcaacagaggacgagg
agtcaggaaaaattctggctagttgtcactcatattggagatcctaaagcagcttttctg
ctgctctttcctttcacctatttcatcagcaaacgagctggagttgcggtgctttgggta
gcagctatatcagagtggttaaacttggtgtttaaatggatgctgtttggagaaagacca
ttctggtggataggtgaatcacgtctatttgtcaacaagcagcccaaagttcatcagttt
tcctccacctgtgaaaccggaccaggcagtccgtcgggacatgcgatggtgacagcagca
gtgtggtgggttgtggtgtcctcactgggatcatttctgtattcccgtactcacagtgtg
gtgttatcagctgctccctacctgttctatgtgttgatgctggtggcagttggaatctcc
aggatcttcatcctggctcacttccctcaccaggttgttgctggctccattacaggcctc
attctggggattgtcctgagccgcagagtaccagaaggtcgccccctgctgttcttcttc
aacttcagcattggtctgctgctcagtgctctgatgctgcatgctggattacagcagctg
ggaatcgacctctcctggtctattactttggctaagaaatggtgcagccattccgagtgg
attcgtttggatacagcccccttctcctctctgactcgagattgtggggcccttcttggt
ttggggctggcccagtactggaagcctggaggtttttctctgccatgggctccaagggcg
ttatctctggctatttcatccatgggactttaccacgtgaatcgcctgccactcccgatt
cagccacaaggcctcttctacggcctcttctttgtcaaattcgtcatagtgcctcagatt
gtcatggtgcttgtacctggactggttcaccttttcacacgaaaaaagaagaaggactag

KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111656166
Entry
111656166         CDS       T06058                                 

Gene name
g6pc
Definition
(RefSeq) glucose-6-phosphatase
  KO
K01084  glucose-6-phosphatase [EC:3.1.3.9]
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal00010  Glycolysis / Gluconeogenesis
slal00052  Galactose metabolism
slal00500  Starch and sucrose metabolism
slal01100  Metabolic pathways
slal04068  FoxO signaling pathway
slal04910  Insulin signaling pathway
slal04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:slal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    111656166 (g6pc)
   00052 Galactose metabolism
    111656166 (g6pc)
   00500 Starch and sucrose metabolism
    111656166 (g6pc)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    111656166 (g6pc)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    111656166 (g6pc)
   04920 Adipocytokine signaling pathway
    111656166 (g6pc)
Enzymes [BR:slal01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.9  glucose-6-phosphatase
     111656166 (g6pc)
SSDB
Motif
Pfam: PAP2 DUF4181
Other DBs
NCBI-GeneID: 111656166
NCBI-ProteinID: XP_023263540
LinkDB
Position
Unknown
AA seq 360 aa
MLDAVMDAMQGFGVSTTHYLQTNYQDAQGLFLWVSWAADLRNTFFIFFPLWFHLRASVGI
KLIWVAVIGDWLNLVFKWILFGERPYWWVHETAHYANTVRPHIEQYPMTCETGPGSPSGH
AMGAAGVYYTLVTSILAVMATKKKHGSKKSTNKQWYLKAVLWTLFWGVQVCVCLSRVFIA
AHFPHQVVAGVITGMIVAEIFNRIQWIYSASMKKYFYTTLFLTSFAVGFYLLLKAVGVDL
LWTLEKAQKWCVRPEWVHLDSTPFASLLRNMGTLFGLGLGLHSPLYTETKKSSSTLVKAG
CIISSLFLLHLFDSFKPPTHTAALFYLLSFCKSATVPLITVSIIPYCVNGALSLQNKKGV
NT seq 1083 nt   +upstreamnt  +downstreamnt
atgctcgacgctgtcatggacgccatgcagggctttggggtgagcaccacccactacctg
cagaccaactatcaggatgcccagggcttgtttctctgggtgtcctgggcggcggacctc
aggaacactttcttcatcttcttcccactttggtttcacctgcgggcctcggtgggcatt
aagctcatctgggtggcagtgatcggagactggctcaacttggtgtttaaatggatcctg
tttggggagaggccttactggtgggtccatgagacggctcattatgcaaatactgtccgt
ccccacatcgagcagtaccccatgacctgtgagactggaccaggcagcccctctggacac
gccatgggagctgcaggcgtctactacaccctggtgacctccatcctcgccgtcatggcc
accaagaagaagcatggaagcaagaaatccaccaacaaacaatggtatctgaaggctgtt
ctgtggacgctgttttggggagtccaggtgtgtgtctgtctctccagggttttcatcgcc
gcccactttccccaccaggtcgttgctggtgtcatcacaggtatgatcgttgctgaaatc
ttcaacagaattcagtggatctacagcgccagcatgaagaagtacttctacaccaccctc
ttcttaacctccttcgccgtcggcttctacctgctgctcaaagctgtgggcgtggacctg
ctgtggaccctggagaaagcccagaagtggtgcgtcaggcccgagtgggtccacctggac
tcaacgcccttcgccagcctcctgcgcaacatgggcaccctgttcggtctgggcctgggc
ctgcactcgccgctctacaccgagaccaagaagagcagcagcacgctggtcaaagcaggc
tgcatcatcagttctctgttcctgttgcacctgtttgactccttcaagcctcccacgcac
accgcagcccttttctacctgctgtccttctgcaagagcgccaccgtgcctctgatcacc
gtcagcatcatcccctactgtgtgaacggagctctgagcctgcagaacaagaagggagtg
tga

DBGET integrated database retrieval system