KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111655428
Entry
111655428         CDS       T06058                                 

Definition
(RefSeq) inhibitor of nuclear factor kappa-B kinase subunit alpha-like
  KO
K04467  inhibitor of nuclear factor kappa-B kinase subunit alpha [EC:2.7.11.10]
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal04010  MAPK signaling pathway
slal04068  FoxO signaling pathway
slal04150  mTOR signaling pathway
slal04210  Apoptosis
slal04620  Toll-like receptor signaling pathway
slal04621  NOD-like receptor signaling pathway
slal04622  RIG-I-like receptor signaling pathway
slal04623  Cytosolic DNA-sensing pathway
slal04625  C-type lectin receptor signaling pathway
slal04920  Adipocytokine signaling pathway
slal05132  Salmonella infection
slal05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:slal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111655428
   04068 FoxO signaling pathway
    111655428
   04150 mTOR signaling pathway
    111655428
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    111655428
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111655428
   04621 NOD-like receptor signaling pathway
    111655428
   04622 RIG-I-like receptor signaling pathway
    111655428
   04623 Cytosolic DNA-sensing pathway
    111655428
   04625 C-type lectin receptor signaling pathway
    111655428
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    111655428
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111655428
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    111655428
Enzymes [BR:slal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.10  IkappaB kinase
     111655428
Protein kinases [BR:slal01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   111655428
SSDB
Motif
Pfam: IKBKB_SDD Pkinase PK_Tyr_Ser-Thr IKKbetaNEMObind Pkinase_fungal Kdo TBK1_ULD YrbL-PhoP_reg
Other DBs
NCBI-GeneID: 111655428
NCBI-ProteinID: XP_023262602
LinkDB
Position
Unknown
AA seq 762 aa
MEKPPFRQNQNCGDWELKERLGMGGFAHVYLYQHHETNEKLAVKMCRLELTPRNKDRWSR
EIQIMKKLNHINVVTARDVPEEMKHIALNDLPLLAMEYCSRGDLRKVLSKPENCCGLKES
EVLSLLNDVGSGIQYLHENKIIHRDLKPENIVLQNINGKLVHKIIDLGYAKDLDQGSLCT
SFVGTLQYLAPELFENKPYTVTVDYWSFGTMIFECSCGFRPFLHNLQPVQWASKVRNKGP
KDIMAVEELNGEVRFSTHLPYPNNLSRTLLEPMEALLQLMLKWDPVQRGGKLNSDTKKPM
CFEVLEQILSMKVVHILNMTTAQVHSFQLTPDESLHSLQKRIEAETRIEVVNQELLQETG
VSLDPRKPAAQCVLDGVRGWDSYIVYLFDKSITKYSGPFSARQLPDKVNTIVQEAKTQLP
LVALKKVWGEAVSYICGLKEDYSRLFQGQRAAMLSLLRYNTNLTRCKNSMFGFSQQLKAK
LDFFKSSIQYDLEKYSDQMHYGISSEKMLKAWQENEERAAAFAQVAEVSHLDDEIMALHS
EIVELQRSPYARRQGDKMEQLEEKAIELYKQLKMKCKIPEPDVSSDSSEMVKAIIQTVQN
QDKVLKDLYTHLSKILISKQKIIDLFPRIEKTLESIKDADNTVMQMQIKRQREFWHLLKI
ACAQNSSRSSIAASPESSNLLQVSQWSQSAQPVSSPHPLTSLPGPNDSDAAPRLLQENQK
YLSQLTSLMQEAADEQGKSIVDQDWSWTKYETLTTKLKKRNA
NT seq 2289 nt   +upstreamnt  +downstreamnt
atggagaaacctcccttcaggcagaaccagaactgcggagactgggagctgaaagagagg
ctgggaatgggtggctttgcccatgtctacctctaccaacatcatgaaacaaatgaaaaa
ctggcagtgaagatgtgtcgtctggagctcacgccaagaaataaggacagatggagcaga
gaaatccagatcatgaaaaaattaaatcacataaatgttgtgacagcccgagatgtcccg
gaggagatgaagcacatagccttaaatgatcttccactgctagccatggagtactgctcc
agaggagacctgaggaaggtgctgagcaaacctgaaaactgctgcggtttgaaggagagc
gaagtgctttcattactgaatgatgttggatctggtatccagtatctgcatgaaaacaag
atcatccacagagatcttaaacctgaaaacatagtgctgcaaaatatcaatggaaagctc
gttcacaaaatcattgacctgggctacgcaaaagaccttgaccagggtagtctgtgtact
tcatttgtcggcacgctgcagtacctggcacctgagctctttgagaataagccatacacg
gtcactgtggactactggagctttggcacaatgatatttgaatgcagttgtggttttcgt
cctttcttgcacaacctgcaacctgtgcagtgggccagcaaagtacggaataaaggtcca
aaggacatcatggctgtagaggaattaaacggagaagtcagattctccacacaccttccg
taccccaacaatctgagcaggactctgttggagcccatggaggctctgcttcagctgatg
ttaaagtgggatcctgtccagagaggaggcaaactgaactccgacactaagaaacccatg
tgctttgaagtgctggagcagatactgagtatgaaagttgtgcacatcctgaacatgacc
acagctcaggtccactccttccagctgactccggacgagagtctccacagtttgcagaag
cgcattgaggcagagaccaggatcgaggtggtgaaccaggagctgctgcaggagacgggc
gtgtcactggacccccggaagcctgctgcacagtgtgtcctggatggagtgagaggctgg
gacagctatatcgtctacctgtttgacaagagcatcaccaagtactctggtcccttcagt
gccagacagctgcctgacaaagtcaacactattgtccaagaggccaagacccagctgccc
ctggttgcactgaagaaggtttggggtgaagcagtgagctacatctgcggtctgaaggag
gactacagcagacttttccaaggacagagggctgctatgttgagcctcctgcgctacaac
accaacctgaccaggtgtaagaacagcatgttcggcttctctcagcagctgaaagccaaa
ctggacttcttcaagagcagcatccagtatgacctggagaaatacagtgatcagatgcac
tatggcatatcctctgagaagatgctgaaagcctggcaggagaacgaggagagagctgct
gcgtttgcacaggtggcagaggtgagccatttggatgatgagatcatggctctgcactct
gagatagtggaacttcagaggagcccgtacgcccgacgccaaggagacaagatggagcag
ctagaagaaaaggccatcgagctctataagcaactgaagatgaagtgcaaaatacctgag
ccagatgtgagcagtgacagttctgagatggtgaaggccatcattcagacagtccagaac
caagacaaggtcctcaaagatctgtacacccacctcagtaagatcctaatcagcaaacag
aagatcattgacttgtttccgcgaattgagaaaactctggagagcatcaaggatgcggac
aacacagtgatgcagatgcagataaagagacagagagagttctggcatctactgaagatt
gcatgtgctcaaaactcgtcacgcagctcgatagcagccagtcccgagtcgtccaacctg
ctgcaggtttctcagtggtcacagtcagcacagcctgtcagctccccacatcctctcacc
tccctacctgggccaaatgacagtgatgctgccccacgtctgctgcaggagaaccagaag
tacctcagtcagctgaccagcctgatgcaggaggctgctgatgaacagggcaagagcata
gtggaccaagactggagctggacaaaatacgaaactttaacaacaaaattaaaaaagcga
aatgcgtaa

KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111658207
Entry
111658207         CDS       T06058                                 

Definition
(RefSeq) inhibitor of nuclear factor kappa-B kinase subunit alpha-like
  KO
K04467  inhibitor of nuclear factor kappa-B kinase subunit alpha [EC:2.7.11.10]
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal04010  MAPK signaling pathway
slal04068  FoxO signaling pathway
slal04150  mTOR signaling pathway
slal04210  Apoptosis
slal04620  Toll-like receptor signaling pathway
slal04621  NOD-like receptor signaling pathway
slal04622  RIG-I-like receptor signaling pathway
slal04623  Cytosolic DNA-sensing pathway
slal04625  C-type lectin receptor signaling pathway
slal04920  Adipocytokine signaling pathway
slal05132  Salmonella infection
slal05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:slal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111658207
   04068 FoxO signaling pathway
    111658207
   04150 mTOR signaling pathway
    111658207
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    111658207
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111658207
   04621 NOD-like receptor signaling pathway
    111658207
   04622 RIG-I-like receptor signaling pathway
    111658207
   04623 Cytosolic DNA-sensing pathway
    111658207
   04625 C-type lectin receptor signaling pathway
    111658207
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    111658207
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111658207
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    111658207
Enzymes [BR:slal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.10  IkappaB kinase
     111658207
Protein kinases [BR:slal01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   111658207
SSDB
Motif
Pfam: IKBKB_SDD Pkinase PK_Tyr_Ser-Thr IKKbetaNEMObind Pkinase_fungal Kdo TBK1_ULD YrbL-PhoP_reg
Other DBs
NCBI-GeneID: 111658207
NCBI-ProteinID: XP_023266402
LinkDB
Position
Unknown
AA seq 734 aa
MERTALRQSQLCGSWEMKERLGMGGFGHVYLYQHIELGDKIAVKLCRLELNSKNKDRWSR
EIQIMKKLNHVNVVQAREVPEELSSIAINDLPLLAMEYCSRGDLRKVLNKPENCCGLKES
EVLSLLSDIGSGIQYLHENKIIHRDLKPENIVLQEIGEKLVHKIIDLGYAKDLDQGSLCT
SFVGTLQYLAPELFESKPYTVTVDYWSFGTVIFECTCGFRPFLHHMQPVQWTSKVKNKGP
KDIMAVEDMNGEVRFSTHLPYPNNLSRPLLEPVETLLQMLLLWDPAMRGGGLDPERNKPN
CYTTLQNILNTKVIHVLDMTSAQLHSLVLGAEESLHSLQLRLETHTQTRISPLSQELLLD
TGISLDPRRPPAHCLPDGLQGWDSSIVFLFDKSLTKYSGPLTARPLPDSVNFIVRETKTQ
LPLSALRKVWGEAVSYICGLKEDYIRLYQGQKSAMLSLLRYNTNLTRYKNLLFSQSQQLR
AKLAFFKTSIQHDLEQYTKQRHTGISSEKMLKTWQENEEKADGFTKVADVGYLDEEIVAL
HSEIVELQRSPFARRQGDVMEQLEEKAIELYKQLKAKCKSPDPPHGYSDSSDMVKTILQT
VQNQDRVLKDLYTHLSTILVCKQRIVDLFPKLERAVENIKTAEAAVMQMQMKRQKEFWYL
LKIACAQSNSPSQPLMQRPTDSETVHQLLDENQRYLNQLTSLLQDATQEMDFSVMDQDWS
WTQYRAVKAQPQKL
NT seq 2205 nt   +upstreamnt  +downstreamnt
atggagcggactgcactcagacagagccagctctgtggctcctgggagatgaaggagaga
cttgggatgggaggttttggacacgtctacctgtaccagcacattgagctgggagacaag
atcgctgtgaaactttgtcgcctggagctgaactccaagaacaaagaccgctggagcaga
gagatccagatcatgaagaagctgaaccatgtgaacgttgtccaggccagagaagtaccg
gaggagttgagctccattgctataaatgatctacctctattggccatggagtactgctca
agaggagacctacgcaaggtgttgaataaaccagaaaactgttgtgggctaaaggaaagt
gaagtcctctcgctgctcagtgacattggttctggtatccagtatctccatgaaaacaag
atcattcacagagaccttaagccagagaacatagttctgcaggagatcggtgagaagctt
gtccataaaatcatagatctgggttacgccaaagacctagatcagggcagtctctgcaca
tcatttgttggaactctccagtatctggctccagagctgtttgagagtaaaccctacact
gtaactgtggactactggagttttgggacagtgatctttgaatgtacttgtggctttcgc
ccctttttacaccacatgcagcctgtacagtggacaagtaaagtcaagaacaaaggccca
aaggacatcatggcagtagaggacatgaatggagaagtcagattctccacacatctgcca
tatcccaacaatctcagcaggccactgctggagcccgttgagactctactacagatgttg
ttactgtgggaccctgcaatgcgtggtggagggctggatcctgagagaaacaagccgaac
tgctacactactcttcagaatattctcaacacgaaggtgattcatgtgttggacatgacg
tcagcccagctgcactccttggttttgggagctgaggagagcttacactccctgcagctt
cgtctggagacacacacacagacacgcatttccccgctgagtcaagagctgctgctggac
acgggaatctccctcgacccacgcagaccacccgcacactgtctgccagatggattgcaa
ggctgggacagctccatagtcttcctgtttgataagagcctgaccaagtactctggacca
ctgactgccagacctctgccagacagtgtcaactttatagtcagggagaccaagacacag
ctcccactgtctgcactgagaaaggtgtggggggaagcagtcagctacatttgcggactg
aaagaggactacattcgcctgtaccagggacagaaatctgccatgctgagtctgctgcgt
tataacaccaacctaacgcggtacaagaacctgctgttctcccagtcacagcagctccga
gccaaactggctttctttaagaccagcatccagcacgaccttgagcagtacaccaagcag
aggcacaccggcatctcttcagaaaaaatgttgaagacatggcaggaaaatgaagaaaag
gctgatgggtttacaaaggttgcagatgtggggtatctggatgaagagatcgtggctcta
cattctgagattgtggaattgcagaggagtccatttgcgaggagacaaggggatgtaatg
gaacagcttgaggaaaaggctattgaactctacaagcaactaaaagctaaatgcaaaagt
cctgaccctccacatggctacagtgacagctcagacatggtgaagaccatactccaaacg
gttcagaaccaggacagagtgctgaaagacttgtacactcacctgagtacaattctggtg
tgtaagcagcgcatcgttgatttgttccctaagttggagagggctgtagagaacataaaa
actgcagaagcagcagtgatgcagatgcagatgaagcgacagaaagagttctggtatctc
ctcaagattgcctgtgcccagagcaattctccatcgcagccacttatgcaacgacccact
gacagtgaaactgttcatcaattactggatgagaatcagcgttacctgaatcagttaact
tctctgctgcaagacgccacccaggagatggacttcagtgttatggatcaggactggagc
tggactcagtacagagcagtgaaagctcaacctcagaagctgtaa

KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111659926
Entry
111659926         CDS       T06058                                 

Gene name
ikbkg
Definition
(RefSeq) NF-kappa-B essential modulator isoform X1
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal04010  MAPK signaling pathway
slal04210  Apoptosis
slal04620  Toll-like receptor signaling pathway
slal04621  NOD-like receptor signaling pathway
slal04622  RIG-I-like receptor signaling pathway
slal04623  Cytosolic DNA-sensing pathway
slal04625  C-type lectin receptor signaling pathway
slal04920  Adipocytokine signaling pathway
slal05132  Salmonella infection
slal05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:slal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111659926 (ikbkg)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    111659926 (ikbkg)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111659926 (ikbkg)
   04621 NOD-like receptor signaling pathway
    111659926 (ikbkg)
   04622 RIG-I-like receptor signaling pathway
    111659926 (ikbkg)
   04623 Cytosolic DNA-sensing pathway
    111659926 (ikbkg)
   04625 C-type lectin receptor signaling pathway
    111659926 (ikbkg)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    111659926 (ikbkg)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111659926 (ikbkg)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    111659926 (ikbkg)
Protein kinases [BR:slal01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   111659926 (ikbkg)
SSDB
Motif
Pfam: CC2-LZ NEMO zf_C2H2_10 HBS1_N
Other DBs
NCBI-GeneID: 111659926
NCBI-ProteinID: XP_023268782
LinkDB
Position
Unknown
AA seq 638 aa
MTAWVPVIPDNTTEKGVGMVQPQPDGPMQWDMSGEESGGALRVPPELAANEVVTRLLGDN
QQLREALRRSNLALRQRCEEMEGWQRRTREEREFLSSRFQEARALVERLAQENHSLQSLV
SGPTSSSNHCCSSSQTEDLQGRPARNGPLEGPQTLDQRDKKRVEETDQHTQTTPPRSLGG
ASVHSSLSSPLPTPPTSFSEVLGEVMGRESGQPVEGANEFLQLLKSHKEKLEEGMRELRR
KNEELERDREEGEKERERMRRCIDQLRAKLAQAQVSNVTEENVPHRSEAQHSSDCSSLAK
LTEQLQATQGRYRELEEKLDYLQKSSAQRDRTEALLKQKDKDCAQLAKDCEALKAQATSL
LGELNERQSCLEKSEHERKMLEEKLCSKLKALQVAERELEQQRKQHHVAMDKLLLQTQSL
EQALKTERHVVTEEKKKLTQLQHAYTCLFRDYDSKLKSEGGDLCSRLEEAERALALKQDL
IDKLKEEVEQQKGSLETVPVLAAQAEIYKADFLAEREAREKLNQKKEELQDQLNQAQAEI
ERLKQDAASRARMEQMKMRHMEDFPPRAPLIPPPQGVFPGPAFNTVPPAPSFRNQGLVPV
GDQGAAGAEELPDLCCPKCQYQAPDMDTLQIHVMDCIQ
NT seq 1917 nt   +upstreamnt  +downstreamnt
atgacagcctgggtgcctgttattccggacaacacaactgaaaaaggagtggggatggtg
cagccccaacctgatggcccaatgcagtgggacatgtcaggagaggagagtggaggggcc
ctcagggtcccaccagagcttgctgccaatgaagtggtgaccaggttgctgggtgataac
cagcagcttagagaggccttgcggcggagcaacctggccttgcgtcagcgctgtgaggag
atggagggatggcagcgaaggacaagagaggaaagagaatttctcagctctcgtttccag
gaggccagggccctggtggagaggctggcccaggagaaccactccttacagagcctggtc
agtggtccgacctcctcttctaaccactgctgcagctccagccaaaccgaagacctgcaa
ggacgcccagccaggaacggtccactcgaaggaccacagactctagatcagcgggacaag
aagagagttgaagagacggatcaacacacacagaccacgccacctcgcagcctgggcggt
gcgagtgtgcatagctccttgagtagccccctccccactccccccacctcattttcagag
gtactgggggaggtgatgggcagggaaagtggccagcctgtggaaggtgcaaacgagttc
ctgcagctgctgaagagccataaagaaaaactggaggaagggatgagagagctgaggagg
aagaacgaagagctggagagagacagagaagagggagagaaagagagagaacggatgcgg
cgctgcattgaccaactacgagccaaactggcgcaggcacaggtgagcaacgttactgag
gagaatgttccacatcgctctgaggcgcagcactcctctgactgctctagcctggctaaa
ctcacagagcagcttcaggccacacagggcaggtatcgggagctggaggagaagcttgat
tacctgcagaagagttcggctcagcgagacagaactgaagctctgctcaaacagaaggac
aaagactgtgctcagctggccaaagactgtgaggctctgaaagctcaggcaacttccctg
ttaggagaactgaatgagagacagagctgcctggagaaaagcgagcatgaacgcaaaatg
ttggaagaaaaactgtgcagtaagctgaaggccctgcaggtggcagagcgggagctggag
cagcagaggaagcagcatcatgtggccatggacaagctgctgctgcagacccagagcctg
gagcaggccctgaagacagagagacatgtcgtcacagaggagaaaaaaaaactgacacag
ctgcaacacgcctacacatgtctctttagagactacgactctaaactgaagagtgaggga
ggagatctgtgcagccgactagaggaggcagagcgagcgctggctctgaagcaggatctg
atcgataaactgaaggaggaggtggagcaacagaaaggctccctggagactgttcctgtc
ctcgctgcacaggctgagatctacaaggcagatttcctggcagagcgagaagcaagagag
aagttgaaccagaagaaggaggagctgcaagatcaactgaatcaggcccaggctgagatt
gaaaggctcaaacaggatgctgcatcacgcgcacgtatggagcaaatgaagatgaggcac
atggaggactttccaccacgggccccgctcattcctcctccacaaggtgtgttccccggg
ccagcttttaacacagtgccccctgccccctcattccgcaatcagggtttggtaccagtc
ggtgatcaaggagcagctggagctgaggagctgccagatttatgttgtccaaagtgccag
taccaggctccagatatggacacactgcagatacatgtcatggactgtatacagtaa

KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111665990
Entry
111665990         CDS       T06058                                 

Gene name
ikbkb
Definition
(RefSeq) inhibitor of nuclear factor kappa-B kinase subunit beta
  KO
K07209  inhibitor of nuclear factor kappa-B kinase subunit beta [EC:2.7.11.10]
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal04010  MAPK signaling pathway
slal04068  FoxO signaling pathway
slal04150  mTOR signaling pathway
slal04210  Apoptosis
slal04620  Toll-like receptor signaling pathway
slal04621  NOD-like receptor signaling pathway
slal04622  RIG-I-like receptor signaling pathway
slal04623  Cytosolic DNA-sensing pathway
slal04625  C-type lectin receptor signaling pathway
slal04910  Insulin signaling pathway
slal04920  Adipocytokine signaling pathway
slal05132  Salmonella infection
slal05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:slal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111665990 (ikbkb)
   04068 FoxO signaling pathway
    111665990 (ikbkb)
   04150 mTOR signaling pathway
    111665990 (ikbkb)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    111665990 (ikbkb)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111665990 (ikbkb)
   04621 NOD-like receptor signaling pathway
    111665990 (ikbkb)
   04622 RIG-I-like receptor signaling pathway
    111665990 (ikbkb)
   04623 Cytosolic DNA-sensing pathway
    111665990 (ikbkb)
   04625 C-type lectin receptor signaling pathway
    111665990 (ikbkb)
  09152 Endocrine system
   04910 Insulin signaling pathway
    111665990 (ikbkb)
   04920 Adipocytokine signaling pathway
    111665990 (ikbkb)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111665990 (ikbkb)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    111665990 (ikbkb)
Enzymes [BR:slal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.10  IkappaB kinase
     111665990 (ikbkb)
Protein kinases [BR:slal01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   111665990 (ikbkb)
SSDB
Motif
Pfam: IKBKB_SDD Pkinase PK_Tyr_Ser-Thr Pkinase_fungal TBK1_ULD Kdo ubiquitin APH Glyco_hydro_65m YrbL-PhoP_reg
Other DBs
NCBI-GeneID: 111665990
NCBI-ProteinID: XP_023276934
LinkDB
Position
Unknown
AA seq 743 aa
MNRVPLQQPQSCGSWELKERLGTGGFGNVTRWQNKDTEEQVAIKQCRQELSDRNKERWCL
EIQIMKRLDHVNVVAAREVPEGMQKMVATNDLPLLAMEYCQGGDLRKYLNLLENCCGMRE
GSVLILLRDISSALTYLHKKRIIHRDLKPENIVLQQGEKRLIHKIIDLGYAKELDQSSLC
TSFVGTLQYLAPELIERQKYTVTVDYWSFGTLVFECITGFRPFLPTWQPVPWHNKLRLKQ
DDDIVVYEDLSGEVRFSKHVPQPNNLNSLLLEKMERWLQLMLKWSPQERGKDHDATPSNC
FSQLEIILQLKLVHVLNMMSAKILTYSVSDDETVADLQLRIEKDTDIPAANQELLLEAGL
ALEPNGLATQCAIDYTEIDGRRTDLPLVFLFDRSSCSYEPQFAPRTLPENIRFVQTDPKH
LLAYSPLRRTCGQAWHTIRSLKEDWQRLQQGQKAAIMSLLRHNSSLSKQKNEMVSMHQRL
TAKLDFFTTSLHIDMDKYQEQTATGIASEKLLCVWREMEQTAVSCGQAKVSELEEEMMQL
QPDIVDVQRQPWRSGEALDTLEGRAMELFRKLREKPRDQRCSGDSQEVVRLVLQAVQFYE
KKLRDFYTHLSKTAVCRQRVMELLPKVEGVVQKMAESEQVLMSLQEKRQRELWNLLKVAC
SKVRSPVSGSPDGLRTPSSVPPLLTPRQSLQQLDESLVEQSRTFESRLQSLLHDTIQESE
NSMEMLREWTWLHGGQSFSSDLS
NT seq 2232 nt   +upstreamnt  +downstreamnt
atgaatcgagtccccctgcagcagccacagagctgcgggtcctgggagctgaaggagcgc
ctggggaccggaggcttcgggaatgtcacaagatggcaaaataaggacacagaggagcag
gtcgctataaagcagtgccgtcaggagctgagtgacagaaacaaagagagatggtgtctg
gagatccagatcatgaagaggttggatcatgttaacgtcgttgcagccagagaggttcct
gaaggaatgcagaaaatggtggccaccaatgacctgccactgctggccatggagtattgc
cagggaggagatctaagaaagtatctgaaccttctggagaactgctgtggaatgagggag
ggctctgttttgattctgttacgggacatttcttcggctctgacctacctccataagaag
aggatcatccacagagatctgaagccagaaaacattgtgctgcagcaaggagagaagaga
ttgatccacaagattatagatctcggctacgctaaagagttggaccagagcagcctttgc
acatcatttgtgggaacactgcagtacttagctccagagctgattgagaggcagaagtac
acggtcactgtggactactggagcttcgggactttggtgtttgagtgtatcacaggattt
cgccctttcttaccgacctggcagcctgtcccctggcacaataaactgaggctgaagcag
gacgatgacattgtcgtctatgaggacctctccggagaagtccgcttctccaaacacgtg
ccccagcccaacaacctcaacagtctgttattagagaaaatggagaggtggctgcagctg
atgttgaagtggtctcctcaggagagaggcaaagaccacgatgctactcccagcaactgc
ttctcccagctggagatcatactacagctcaagctggttcacgtcctaaacatgatgtct
gctaagatcctgacgtactcggtctcggacgatgagaccgtggccgacctgcagctgaga
atagaaaaagacaccgacatccccgcagccaatcaggagctgctgctggaggcgggatta
gccttggagcctaacggactggccacgcagtgtgccatagattacacagaaatagatggt
cgacggacagacttgcctctggtcttcctgtttgatcgctcctcttgcagttatgagccc
cagtttgctcctcgcacgctccctgaaaacatccgcttcgtgcagactgaccccaagcac
cttctggcttacagccctctgaggaggacctgcggccaggcgtggcacaccatccgctcc
ctgaaggaagactggcaaagactgcagcaggggcagaaagctgccatcatgagcctgctg
agacacaactcctcactgtccaaacagaagaatgagatggtgtccatgcaccagagactc
acagccaagctggacttcttcaccaccagccttcacatagacatggacaaataccaggaa
cagacagccactgggattgcgtcagagaaactcctctgcgtgtggagggagatggagcaa
actgctgtcagctgtggtcaggccaaggtgagtgaactggaagaagagatgatgcagctg
cagccagacatagtggatgtgcagaggcagccgtggaggagtggagaggctctggacaca
ctggaaggaagggccatggagctgttccgtaaactcagggagaaacccagagaccagagg
tgctcaggagacagtcaggaggtggtgcgtctggtacttcaggctgtgcagttctatgag
aagaagctcagagacttctacacacacctcagtaagacggcggtgtgccgtcagcgtgtg
atggagctgctgccgaaggtggagggcgtggtccagaagatggcagagagcgaacaagtc
ctgatgagtctgcaggagaaacgacagagggagctgtggaacctgctcaaagtcgcctgt
agtaaagttcgcagcccagtgagtgggagccctgatggattacgcaccccctcgtcagtg
ccgcctcttctgaccccgagacaaagcctacagcagcttgatgagtctctcgtggagcag
agcaggacgtttgagagtcgactccagagcttgcttcatgacaccatccaggaatcagaa
aacagtatggagatgttgagggagtggacgtggctgcacggaggccagagtttctccagt
gacctctcctga

DBGET integrated database retrieval system