KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111655951
Entry
111655951         CDS       T06058                                 

Gene name
rxra
Definition
(RefSeq) retinoic acid receptor RXR-alpha
  KO
K08524  retinoid X receptor alpha
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal03320  PPAR signaling pathway
slal04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:slal00001]
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    111655951 (rxra)
   03320 PPAR signaling pathway
    111655951 (rxra)
Transcription factors [BR:slal03000]
 Eukaryotic type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    111655951 (rxra)
Nuclear receptors [BR:slal03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   111655951 (rxra)
SSDB
Motif
Pfam: Hormone_recep Nuc_recep-AF1 zf-C4
Other DBs
NCBI-GeneID: 111655951
NCBI-ProteinID: XP_023263292
LinkDB
Position
Unknown
AA seq 496 aa
METKPFLSLGFLKPQCSLAPPMQRGRSGEACSCFSGVCPLHQRRLSSDSSGQMTSSPLGS
PTSHRGMHPSLLSPTSMGPSGSLHSPISTLSSPMNGMASPFSVISSPMGPHSMNSPGMGY
GPSVSPQLNSPMNSVSSTEDIKPPLGLNGVMKVPAQPSGTALSLTKHICAICGDRSSGKH
YGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCVIDKRQRNRCQYCRYQKCLAMGMKREAVQ
EERQRAKDKNENEVESTSCANEDMPVEKILEAEQAVEPKTETYIETNLGVPSNSPNDPVT
NICQAADKQLFTLVEWAKRIPHFSELPLDDQVILLRAGWNELLIASFSHRSIAVKDGILL
ATGLHVHRNSAHSAGVGAIFDRVLTELVSKMRDMQMDKTELGCLRAIVLFNPDSKGLSNP
GEVEALREKVYASLEAYCKQKYPEQPGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTP
IDTFLMEMLEAPHQMT
NT seq 1491 nt   +upstreamnt  +downstreamnt
atggaaaccaaaccattcttgtcattggggttcctgaagccccagtgctcgttggctcct
cccatgcagcggggtcgctcaggcgaggcatgttcctgtttcagtggcgtgtgtcccctc
catcagcgtcgcctatcctcagactcttcaggccagatgacctcctcgcccctgggctca
cccacatcccaccggggaatgcacccgtctcttctcagcccgacgtccatggggccctct
ggctctcttcactctcccatcagcacgctgagttcacccatgaacggcatggcctcacct
ttctccgtcatcagctcacccatgggccctcactccatgaactcgccaggcatgggctac
ggccccagcgtcagcccccagctgaactctccgatgaactcggtcagcagtacggaggac
attaagcccccgctgggcctcaacggtgtgatgaaggtgcccgcccagccctcaggcaca
gccctgtcgctcacaaaacacatctgcgccatctgtggtgaccgctcctcaggtaaacac
tatggggtatacagctgtgagggctgcaaaggttttttcaaaaggacggtgcgcaaagac
ctgacctacacctgtcgtgataacaaggactgtgtcatcgataaacgccagaggaaccgc
tgccagtactgtcgctaccagaagtgtttagccatgggcatgaagagagaagccgttcag
gaggagcgccagcgagccaaggacaaaaatgagaacgaggtggagtccaccagctgcgcc
aacgaggacatgcccgtggagaagatcctggaagccgagcaggcggtggaacccaaaacg
gagacctacattgagaccaaccttggtgtgccatcaaactcgcccaacgacccagtgaca
aatatctgtcaggcggctgacaaacaactcttcacactggtggagtgggccaagaggatc
ccccacttctctgagctgccgctggacgaccaggtcatccttctacgagcaggttggaat
gagctcctcattgcatcattttcgcaccgttcgatagcggttaaagacgggattctgttg
gcaaccgggctgcatgtacaccgcaacagcgctcatagtgccggagtgggagccatcttt
gacagagtgctcacagaactggtgtctaagatgagggacatgcagatggataagacagaa
ctggggtgccttcgagctatagtccttttcaacccagactcaaaaggtctgtccaaccca
ggtgaggtagaagccctaagagagaaagtctatgcgtctttagaggcctactgcaaacag
aaatacccagagcagcctggcaggtttgccaagctgttgctgcggttaccagcgctgcgc
tcgatcggcctgaagtgtctggagcacttgttcttctttaagctcatcggcgacacgccc
atcgacaccttcctcatggagatgctagaggctccacatcaaatgacataa

KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111656331
Entry
111656331         CDS       T06058                                 

Definition
(RefSeq) retinoic acid receptor RXR-gamma-B isoform X1
  KO
K08526  retinoid X receptor gamma
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal03320  PPAR signaling pathway
slal04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:slal00001]
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    111656331
   03320 PPAR signaling pathway
    111656331
Transcription factors [BR:slal03000]
 Eukaryotic type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    111656331
Nuclear receptors [BR:slal03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   111656331
SSDB
Motif
Pfam: Nuc_recep-AF1 Hormone_recep zf-C4
Other DBs
NCBI-GeneID: 111656331
NCBI-ProteinID: XP_023263771
LinkDB
Position
Unknown
AA seq 515 aa
MIVLDPDIDHCCHWEKPCFAAPPPSLGPRVEPPCRVQSRWERNALGCGAAPTVGNRRNNS
HSMDSNDPYLHLNSTGPMSTAHTHPPPMGGMVGHPSVISTSRPLPSPMSTLGSPMNGLAS
PYPVITSSLGSPSVSLPSTPNMNFGPLSSPQMNSMNSVSSSEDIKPPPGLQNLGNINYQC
TSPGGMSKHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKECLIDKRQR
NRCQYCRYQKCLAMGMKREAVQEERQRGKERGENEVESTSSFNEDMPVDKILDAELAVEP
KTETYSDGSPGNSTNDPVTNICQAADKQLFTLVEWAKRIPHFSELPLDDQVILLRAGWNE
LLIASFSHRSVTVKDGILLATGLHVHRSSAHSAGVGSIFDRVLTELVSKMKDMQMDKTEL
GCLRAIVLFNPDAKGLSNPPEVEGLREKVYASLESYTKQKYPDQPGRFAKLLLRLPALRS
IGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQIT
NT seq 1548 nt   +upstreamnt  +downstreamnt
atgatcgtgttggatcctgatatcgaccactgttgtcattgggagaagccctgttttgcc
gccccccctccctcgctgggcccccgcgtagagccgccttgcagagttcagtcgcgctgg
gagaggaatgcgctgggatgtggagcggcaccgactgtaggaaatcgacgcaacaactcg
cacagtatggacagtaatgatccgtatttacacctcaactccacagggccaatgagcacg
gcccacacccacccgcctcccatgggtggcatggtgggccacccgtcagtcatcagcact
tccaggcccctgccatcccccatgtctaccttgggctcgccgatgaatggactggcctca
ccctaccccgtcattacatcatcactgggctcaccttctgtgtcgctgccgtccacgccc
aacatgaactttggaccactcagcagtccccagatgaactctatgaacagtgtcagcagc
tcggaggacatcaagcctccgccaggcctacagaacctgggaaacatcaactaccagtgt
acgagccccgggggaatgtcaaagcacatctgcgccatttgcggggaccgctcctcagga
aagcactacggtgtgtacagctgtgagggatgcaaaggcttcttcaagaggaccgtccga
aaagatctcacatacacatgtcgagacaacaaggagtgcctgattgacaagcgccagcga
aaccgctgccaatactgtcgctaccagaagtgcctggccatgggcatgaagagagaagcg
gtgcaggaagagaggcagcgtgggaaggagcgaggggagaatgaggtggaatctaccagc
agtttcaacgaggatatgcctgtggacaagatcctggatgctgagctcgctgtggaaccc
aaaacagagacgtacagtgacggcagccccggaaactctaccaacgacccagtcaccaat
atctgccaagcagcagacaaacagctcttcacactggtggagtgggccaaaaggatcccg
cacttctctgaactcccgctcgatgatcaggtcatcctactacgagcaggctggaacgag
ttgcttattgcctcattctcgcatcgctcagtcacggtaaaagacggcatcctgttggcg
acaggcctccacgtccacagaagcagcgcccatagtgctggagtgggctccatctttgat
agagtcctgacagagctggtatctaaaatgaaagatatgcagatggataaaacagagctt
ggctgcctgcgtgccatcgtcctgttcaacccagacgcaaaaggtctttcaaacccacca
gaggttgaggggctaagggaaaaagtctacgcttcgttggagtcgtatacaaaacagaaa
tacccagaccagcctggcaggtttgccaaactgctgctccgcctgcctgccctgcgctcc
atcggcctcaagtgcctggagcatctgttcttcttcaagctgattggggacacacctatt
gacaccttcctgatggagatgctggaggctccgcatcagatcacatga

KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111661213
Entry
111661213         CDS       T06058                                 

Definition
(RefSeq) retinoic acid receptor RXR-beta-A isoform X1
  KO
K08525  retinoid X receptor beta
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal03320  PPAR signaling pathway
slal04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:slal00001]
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    111661213
   03320 PPAR signaling pathway
    111661213
Transcription factors [BR:slal03000]
 Eukaryotic type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    111661213
Nuclear receptors [BR:slal03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   111661213
SSDB
Motif
Pfam: Hormone_recep zf-C4 Nuc_recep-AF1 SLY
Other DBs
NCBI-GeneID: 111661213
NCBI-ProteinID: XP_023270473
LinkDB
Position
Unknown
AA seq 470 aa
MGDSRDSRSPDSSSVSSPPSGQRSPPLVPSAAASMTSLPPITSAGVNSPISSIGSPFSVI
SSSLGSPCLPGTPSVGYGPISSPQINSTVSMSGLHAVSSSDDVKPPLGLKQLSSHSPGPM
LSQKRLCSICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCMVDKRQRNRCQ
YCRYQKCLAMGMKREVAKMNDRSVQEERQRNKDRDGEVESTSAVNEEMPVEKILEAEMAV
EQKTELHADGSSGGSSPNDPVTNICQAADKQLFTLVEWAKRIPHFSELPLDDQVILLRAG
WNELLIASFSHRSISVKDGILLATGLHVHRNSAHSAGVGAIFDRAHNAEVGAIFDRVLTE
LVSKMRDMQMDKTELGCLRAIILFNPDAKGLSNPSEVELLRERVYASLEAYCKQKYPDQQ
GRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQLT
NT seq 1413 nt   +upstreamnt  +downstreamnt
atgggagacagtagagattcccgcagcccggacagttcatctgtgtcctcccctccatca
ggccaacgctcgccccctctagttccctcagccgcagcttccatgacctcccttcctccc
atcacctctgccggggtcaacagccccatcagtagcatcggctcccccttttccgtcatc
agctcttcgctgggctcaccctgcctccctggcacaccatcagtgggctatggccccatt
agcagcccgcagatcaactcaacagtgtccatgtcggggctacacgcagtgagcagctct
gatgatgtgaaacctccactgggcttgaagcagctgtcgtcccacagcccggggccgatg
ctttcccagaaacgcctttgttccatctgcggtgacagatcctctggtaagcattacggc
gtctacagctgtgagggctgcaaaggtttcttcaagagaacagtgcgcaaagacctgacc
tacacctgtcgggacaataaagactgtatggtggataagagacagaggaaccgctgccaa
tactgccgctaccagaagtgcctggctatgggcatgaagagagaagtggccaagatgaac
gacagatctgtccaagaggaacggcagagaaacaaggatcgagacggtgaggtagagtcg
actagtgcagtgaacgaggagatgcctgtggagaagattttggaagcagagatggctgta
gagcagaagacagagcttcatgcagatggaagttcaggtggcagctctcccaacgatcct
gtcaccaacatctgccaggcagcagacaagcagctcttcaccctggtggagtgggctaag
aggatccctcacttctcggagctgcccctggacgaccaggtcatcctgctacgtgcaggt
tggaatgaactcttgattgcatcgttctcccatcgctccatctcagtgaaagacgggatt
ttactggccaccggcctgcatgtccacaggaacagtgctcacagtgcaggtgttggagcc
atctttgacagggcgcacaatgccgaggttggggccatatttgacagggttttgacagag
cttgtaagcaagatgagagatatgcaaatggacaagacagagctcggctgccttcgagca
atcatcctcttcaacccagatgccaagggtttgtccaaccccagtgaggtggagctcctg
agagagagagtgtatgcgtctctcgaggcttactgcaaacagaaataccccgatcagcag
ggcaggtttgcaaagctgcttctccggctcccagcactgcgctccattggtctaaagtgc
ctggagcacctgttcttcttcaaactgattggtgacacacccatcgacaccttcctgatg
gagatgctggaggcacctcaccagctcacctag

DBGET integrated database retrieval system