KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111656118
Entry
111656118         CDS       T06058                                 

Definition
(RefSeq) tyrosine-protein phosphatase non-receptor type 11-like isoform X1
  KO
K07293  tyrosine-protein phosphatase non-receptor type 11 [EC:3.1.3.48]
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal04625  C-type lectin receptor signaling pathway
slal04920  Adipocytokine signaling pathway
slal05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:slal00001]
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    111656118
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    111656118
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    111656118
Enzymes [BR:slal01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     111656118
Protein phosphatases and associated proteins [BR:slal01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Non-receptor PTPs
    111656118
SSDB
Motif
Pfam: Y_phosphatase SH2 DSPc Y_phosphatase3 PTPlike_phytase Sacchrp_dh_NADP
Other DBs
NCBI-GeneID: 111656118
NCBI-ProteinID: XP_023263473
LinkDB
Position
Unknown
AA seq 595 aa
MTSRRWFHPNITGIEAEQLLLTRGNHGSFLARPSKSNPGDFTLSVRRDDEVTHIKIQNSG
DYYDLYGGEKFATLAELVQYYTEQQDLLRERNGHVIELKYPLNCKDPTSERWYHGHLSGR
DAEKLLTDKGKAGSFLVRESQSKPGDFVLSVLTNEEKHENVDRKTKVTHVMIRYQQDSKY
DVGGGERFETLAELVDHYKKNPMVEKSGIVVHLKQPFNATRINAANIENRVRELNKVADN
SEKPKQGFWEEFEVLQQQECKLLYPRKEGQKPENKSKNRYKNILPFDTTRVEIREADPDV
AGSDYINANYIRCMHEEGRYMEEGKVFIATQGCLQNTVNDFWKMVYQENTHVIVMTTKEI
ERGRNKCVRYWPDFNATKEFGKVQVRNVDEQPAQDYILRKLEVTRLDRKEPVRYIWHYQY
LSWPDHGVPNEPGGVLWFLEDVNRTQNSIPDTGPIVVHCSAGIGRTGTIIVIDILIDIIN
RQGLDCDIDIPKTIQRVRQQRSGMVQTEAQYKFIYMAVQQYIDTAQKRLEEEQRNKMKER
EYSNIKYPPMTNSRSKPNMASSRSSSVMTNDDSSGVYENINFKSPQTSFSSNTRR
NT seq 1788 nt   +upstreamnt  +downstreamnt
atgacatctcgcaggtggttccaccccaacatcaccggaatcgaggcagagcagctcctg
ttgacccggggcaaccacggcagtttcttggcccggcccagcaagagcaatccgggggat
ttcaccctctcggtcaggcgcgacgatgaggtgacccacattaagatccagaactcgggc
gactactacgacctgtacggaggcgagaagttcgccacgctggccgagctggtgcagtac
tacacagaacaacaggatctgctgcgcgagaggaacggccatgtcattgagctcaagtac
ccactcaactgcaaggaccccacctccgagaggtggtaccatggacacctctctgggcga
gacgcggagaaactgctcactgacaaaggcaaggccggcagtttcctggtacgggagagc
cagagtaaaccgggcgacttcgtcctctcggttctcaccaatgaagagaagcacgaaaac
gtggatcgtaagaccaaggtcacgcatgttatgatacgttaccagcaggatagtaaatac
gacgtgggcggaggtgagaggtttgagactctggctgagctggtggatcactacaagaag
aaccccatggtggagaaaagtggcatcgtagtgcatctcaaacagccatttaatgccaca
aggataaatgcagccaacattgagaaccgggtacgagagctcaacaaagtagcagacaac
tctgagaagcccaaacaaggattctgggaagaatttgaggtacttcagcagcaggagtgt
aaactgctgtatccccggaaagaaggccagaagccagaaaacaagagtaaaaacagatac
aagaatatcctccccttcgacacaactcgtgttgaaatcagggaagcagatccagatgtt
gccggttcagactacatcaatgccaactacatcagatgtatgcatgaagaggggcgctac
atggaggagggcaaagtcttcatcgccacccaggggtgcctacagaatacggtcaacgac
ttctggaagatggtgtatcaggagaacacgcacgtcatcgtcatgaccacaaaggaaata
gagcgagggcggaacaaatgtgtacgttactggccggacttcaacgccaccaaggagttt
gggaaggtgcaagtgaggaatgtggacgagcagccagcacaagactacatcctcaggaag
ctggaggtgacccgtctggaccggaaggagcccgtgaggtacatctggcactatcagtac
ctgagctggcccgaccacggggtgcccaacgagcctggtggtgtgctctggttcctagag
gatgtcaaccgcacgcagaactccattccagacactggacccattgtcgtacattgcagc
gcaggcatcggcaggacaggcaccattattgtcatcgacatcctcatcgatataattaac
cgccaaggtctcgattgtgacatcgacatccccaagaccatccagagggtacggcagcag
aggtcgggcatggtgcagacagaggcccagtataagttcatctacatggctgtgcagcag
tacatagacacggctcagaagagactggaggaggagcagaggaataagatgaaggagagg
gaatattccaatatcaaatatcccccgatgaccaactcgaggtccaaacccaacatggcg
tcctcgcgctcctcttctgtgatgacaaacgacgattcatcgggcgtgtacgaaaacata
aactttaaaagccctcagacgtctttcagcagcaacaccaggaggtaa

KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111666017
Entry
111666017         CDS       T06058                                 

Gene name
ptpn11
Definition
(RefSeq) tyrosine-protein phosphatase non-receptor type 11 isoform X1
  KO
K07293  tyrosine-protein phosphatase non-receptor type 11 [EC:3.1.3.48]
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal04625  C-type lectin receptor signaling pathway
slal04920  Adipocytokine signaling pathway
slal05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:slal00001]
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    111666017 (ptpn11)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    111666017 (ptpn11)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    111666017 (ptpn11)
Enzymes [BR:slal01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     111666017 (ptpn11)
Protein phosphatases and associated proteins [BR:slal01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Non-receptor PTPs
    111666017 (ptpn11)
SSDB
Motif
Pfam: Y_phosphatase SH2 DSPc Y_phosphatase3 PTPlike_phytase
Other DBs
NCBI-GeneID: 111666017
NCBI-ProteinID: XP_023276972
LinkDB
Position
Unknown
AA seq 602 aa
MTSRRWFHPNITGVEAENLLLTRGVDGSFLARPSKSNPGDFTLSVRRNGAVTHIKIQNTG
DYYDLYGGEKFATLAELVQYYMEHHGQLKEKNGDVIELKYPLNCADPTSERWFHGHLSGR
EAEKLLTEKGKNGSFLVRESQSHPGDFVLSVRTGDDKTDSSDSKPKVTHVMICCKHDLKY
DVGGGEKFDSLTDLVEHYKKNPMVETLGTVLQLKQPLNTTRINAAEIESRVRELSKLAEA
TDKVKQGFWEEFETLQQQECKLLYSRKEGQRAENKNKNRYKNILPFDHTRVVLNDGDLNE
PGSDYINANIIMVVSTVMPELDSKCNSTKVKKSYIATQGCLQNTISDFWRMVFQENSRVI
VMTTKEVERGKSKCVKYWPDVSALKEYGAMRVRNVRETAAHDYILRELKLSKVGQGNTER
TVWQYHFRAWPDHGVPTDPGGVLDFLEEVNLKQESILDAGPIAVHCSAGIGRTGTFIVID
ILIDVIREKGVDCDIDVPKTIQMVRSQRSGMVQTEAQYRFIYMAVQHYIETLQRRIEEEQ
KSKIKGREYTNIKYSMSDLTGGEQSPLPPCTPIPTPTCTEMREDSSRVYENVGLMQQQKS
FR
NT seq 1809 nt   +upstreamnt  +downstreamnt
atgacatctcggaggtggtttcaccccaacatcacaggtgtggaggctgaaaacctcctg
ctgactcgtggggtggatgggagctttttagccagacccagtaagagtaatccaggagac
ttcaccctctcagtacggcgaaatggagccgtcactcatattaagatccagaacacggga
gactactacgacctgtacggcggggagaagtttgccactcttgcagagctggtgcagtat
tacatggagcatcatgggcaactgaaggagaaaaacggagacgtcattgagctcaagtat
ccgctcaactgtgctgatcccacctcagagagatggttccacggacacttgtcgggccgg
gaggctgagaagctgctgacggagaaagggaagaacggcagcttcctggtgagagagagc
cagagccatccgggggatttcgtcctgtcggttcgtacaggagacgacaagacggacagc
agtgacagcaaacccaaagtcactcacgtcatgatctgctgcaagcacgacctgaaatac
gacgtcggcggaggcgagaagttcgactccctcaccgacttggtagagcactacaaaaag
aaccccatggtggaaactctgggcaccgtgcttcagctaaaacagcctctgaacactact
cgtattaacgcggcggagatcgaaagtcgagttagggagctgagcaaactcgcggaagcc
acagacaaagtcaaacagggcttctgggaagaatttgagacgttgcagcaacaggagtgc
aagctgctctacagtcgtaaagagggccagagagccgagaacaaaaacaagaacagatac
aagaacattctgccattcgaccacacacgcgtggtgctgaatgatggggacctaaatgag
ccgggctccgactacatcaacgccaatatcatcatggtagtatccactgtcatgccggag
ctggactcaaagtgtaacagtaccaaggtgaagaagagctacattgccactcagggctgt
ctgcagaacaccatcagtgacttctggaggatggtgtttcaggaaaactctcgagtcatc
gtcatgacgaccaaagaggtggagagggggaagagtaagtgtgtgaagtactggcccgac
gtgtcggctctgaaggagtacggcgccatgcgcgttcgcaatgtcagagagacggcggca
cacgactacatcttaagagagctcaaactgtccaaagtgggacagggcaacacagaacgt
acagtttggcagtaccacttcagggcctggccggaccacggcgtccccaccgacccgggc
ggtgtactcgacttcttagaggaggtcaacctgaagcaggagagcatactggacgccggg
cctatagcggtacactgcagcgcggggatcgggcggacgggaacgtttatagtgatcgac
atcctgatagatgtgatcagagaaaaaggggtggactgtgacatcgacgtgccaaagacc
atccagatggttcgttctcagcgctctgggatggtgcagaccgaggcgcagtacagattc
atctacatggctgtgcagcattacatagagacgctgcagagacgcatagaggaagagcag
aaaagtaagattaaagggcgcgagtacaccaacattaagtactctatgtctgacctgact
ggaggggagcagagccctttgcctccttgcactcctattcctactcccacctgcacagag
atgagggaggacagctctagagtgtatgagaacgtgggcctgatgcagcagcagaagagc
ttcagatga

DBGET integrated database retrieval system