KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111656119
Entry
111656119         CDS       T06058                                 

Gene name
mtor
Definition
(RefSeq) serine/threonine-protein kinase mTOR isoform X1
  KO
K07203  serine/threonine-protein kinase mTOR [EC:2.7.11.1]
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal04012  ErbB signaling pathway
slal04136  Autophagy - other
slal04140  Autophagy - animal
slal04150  mTOR signaling pathway
slal04218  Cellular senescence
slal04371  Apelin signaling pathway
slal04910  Insulin signaling pathway
slal04920  Adipocytokine signaling pathway
slal05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:slal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    111656119 (mtor)
   04371 Apelin signaling pathway
    111656119 (mtor)
   04150 mTOR signaling pathway
    111656119 (mtor)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    111656119 (mtor)
   04136 Autophagy - other
    111656119 (mtor)
  09143 Cell growth and death
   04218 Cellular senescence
    111656119 (mtor)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    111656119 (mtor)
   04920 Adipocytokine signaling pathway
    111656119 (mtor)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    111656119 (mtor)
Enzymes [BR:slal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     111656119 (mtor)
Protein kinases [BR:slal01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   111656119 (mtor)
Membrane trafficking [BR:slal04131]
 Autophagy
  Other autophagy associated proteins
   mTORC1 complex
    111656119 (mtor)
SSDB
Motif
Pfam: FAT PI3_PI4_kinase DUF3385 FRB_dom FATC HEAT_2 HEAT_EZ EPSP_synthase Nipped-B_C Coatomer_E
Other DBs
NCBI-GeneID: 111656119
NCBI-ProteinID: XP_023263477
LinkDB
Position
Unknown
AA seq 2534 aa
MVIMSGTATVLQQFVSGLKSRNEDTRAKSAKDLQHYVTTELRELSQDEATTFYDELNHHI
FELVSSSDVNEKKGGILAIVSLIGVEGGNATRISRFANYLRNLLPSSDPVVMEMASKAMG
HLSMAGDTFTAEYVEFEVKRALEWLGADRNEGRRHAAVLVLRELAVSAPTFFFQQVQPFF
DNIFYAVWDPKQAIREGAVSALRACLILTTQRETKEMQKPQWYKQTFEEAEKGFDETLAK
EKGMNRDDRVHGALLILNELVRISSMEGERMREEMEEITQQQLVHDKYCKELMGFGTKPR
HITPFTSFQSVQPQQSNALLGLLGYSTPQGFLSFGATPVPAKTSLVESRYCRELMEERFD
QVCRWVLKYKASKNPLIQMTILNLLPRLAAFQPHTFTGGTHSCLNVVHDPVESIFDQYLS
DTMGYLLGCLKKEKERTAAFQALGLLVVAVRAEIQPYLSKILEIIKAALPPKDFAHKRQK
TMQVDATVFTCISMLSRAMGPSIQPDIKELLEPMLAVGLSPALTAVLYDLSRQIPQLKKD
IQDGLLKMLSLVLMHKPLRHPGMPKGLAHQLASPSLTNIPEASDVGSITLALRTLGSFEF
EGHSLTQFVRHCADHFLNSEHKEIRMEAARTCSRLLTPSIHLINGHVVSQTAVQVVADVL
SKLLVVGITDPDPDIRYCVLASLDERFDAHLAQAENLQALFVALNDEVFEIRELAICTIG
RLSSMNPAFVMPFLRKMLIQILTELEHSGVGRNKEQSARMLGHLVSNAPRLIRPYMEPIL
KALILKLKDPDPNPGVVISVLATIGELAQVSGLEMRKWMDELFPIIMDMLQDSSSLAKRQ
VALWTLGQQVASTGYVVEPYRKYPSLLEVLLNFLKTEQNQGIRREAIRVLGLLGALDPYK
HKVNIGMIDQSRDASAVSLSESKSSQDSADYSTSEMLVNMGNLPLDEFYPAVAIVTLMRI
LRDPSLSNHHTMVVQAVTFIFKSLGLKCVQFLPQVMPTFLNVIRVCDASIREFLFQQMGM
VVCFVKIHIRPYMDDIFTLIREYWTPNNPMQNTIILLIEQIVVALGGEFKLYLPQLIPHM
LRVFMHDNSTGRSVTIKLLNAIQLFGANLDDYLHLLLPPIVKLFDAPDVPLQARKVALET
LDRLTESLDFTDYASRIIHPIVRTLDSTPELRSTSMDTLSSLVFQLGKKYQIFIPMVNKV
MLKHRINHQRYDILICRIVKGYTLAEEEEDPLIFQHRQLRGNQGDALVSGPVEAGPMKKL
HVSTTALQKAWGAARKVSKDDWLEWLRRLSVVLLKESSSPALRSCWSLAQTYIPLARDLF
NAAFLSCWSELSEDQQDELIRSIELALTSQDIAEVTQTLLNLAEFMEHSDKGPLPLRDDN
GIVLLGERAAKCRAYAKALHYKELEFQKGPSPLILESLISINNKLQQPEAASGVLEYAMK
HFGELEIQATWYEKLHEWEDALVSYDKKIDLNKEDPELILGRMRCLEALGEWGQLHQQCC
EEWTLVSEETQAKMARMAAAAAWGLGHWDSMEEYTCMIPRDTHDGAFYRAVLALHQDLFS
LAQQCIDKARDLLDAELTAMAGESYSRAYGAMVSCQMLSELEEVIQYKLVPERRDIIRET
WWERLQGCQRIVEDWQRILMVRSLVISPHEDMRTWLKYASLCGKSGRLALAHKTLVLLLG
VDPSKQLDHPLPTAHPHVTYAYMKYMWKSTRKIDAFQHMQHFVQGMQQQAQHAIAAEDQQ
HKQEVHKLMARCFLKLGEWQLSLQGINESTIPKVLQYYSHSTEHDRNWYKAWHAWAVMNF
EAVLHYKHQNQGRDEKKKLRHASGASANSEASNSDSEVDSTDHSPVPSPGQKKVNEDLSK
TLLLYTVPAVQGFFRSISLSRGNNLQDTLRVLTLWFDYGHWPEVNEALVEGIKTIQIDTW
LQVIPQLIARIDTPRALVGRLIHQLLTDIGRYHPQALIYPLTVASKSTTTARHNAANKIL
KNMCEHCNTLVQQAMMVSEELIRVAILWHEMWHEGLEEASRLYFGERNVKGMFAVLEPLH
AMMERGPQTLKETSFNQAYGRDLMEAQDWCRKYMRSGNVKDLTQAWDLYYHVFRRISKQL
PQLTSLELQYVSPKLLMCRDLELAVPGTYDPNQPIIRIQSIAPSLQVITSKQRPRKLTIM
GSNGHEFMFLLKGHEDLRQDERVMQLFGLVNTLLANDPASLRKNLSIQRYAVIPLSTNSG
LIGWVPHCDTLHALIRDYREKKKILLNIEHRIMLRMAPDYDHLTLMEKVEVFEHAVNNTA
GDDLAKLLWLKSPSSEVWFDRRTNYTRSLAVMSMVGYILGLGDRHPSNLMLDRLSGKILH
IDFGDCFEVAMTREKFPEKIPFRLTRMLTNAMEVTGLDGNYRITCHTVMEVLREHRDSVM
AVLEAFVYDPLLNWRLMDTNTKGNKRSRTRTDSYTAGQSVEALEGIDLGESTHKKPGTTV
PESIHSFIGDGLVQPEALNKKAIQIINRVRDKLTGRDFSHDETLDVPVQVDLLIKQATSH
ENLCQCYIGWCPFW
NT seq 7605 nt   +upstreamnt  +downstreamnt
atggtgatcatgtcaggcacagccactgtgctgcagcagtttgtcagtggtctgaaaagt
cgaaatgaagacaccagagcaaaatctgccaaagatctgcagcactatgtgactacagag
ctgagagagttaagccaagatgaagccactacattctatgatgagttaaaccatcacata
tttgaactggtatccagttctgatgtgaatgagaagaaaggaggcattctcgccattgtg
agtctgattggagtcgagggaggcaatgccaccaggatcagccgttttgccaactacctg
cgcaacctgctcccctccagcgacccagtggttatggagatggcctctaaagccatgggc
cacctgtctatggccggggacacctttactgcggaatatgtggagtttgaggtgaaaagg
gccctggagtggctgggagcagacaggaatgaaggcagacgccatgctgcagtgttggtg
ttgagggagctggctgtgagcgcacccaccttcttctttcagcaagtgcagcccttcttt
gataacatcttttacgcagtatgggatcccaagcaagccatccgagaaggggctgtgtct
gccctgcgagcctgcctcatcctcaccacacagagggagaccaaggaaatgcagaaacca
cagtggtacaaacaaaccttcgaggaggcagaaaaaggttttgatgagactttggccaaa
gagaaaggaatgaatcgtgacgacagggtccacggtgctcttctgatcctgaatgagttg
gttcgcatcagcagtatggaaggagagcgcatgcgtgaggagatggaggagatcacgcag
cagcagctggtccatgataagtactgcaaggagctgatgggatttggaaccaagccccgc
catatcacccccttcactagcttccagtcggtgcagccacagcagtcaaacgccctcctg
ggcttgttgggctacagcacgcctcagggcttcctcagcttcggagccacaccggtaccc
gccaagacctcactggtggagagccgatactgccgtgagctgatggaggagcgattcgac
caggtatgtcgatgggtgctgaaatacaaggccagtaaaaaccctctgatccagatgacc
atcctcaacctgcttccacgcctggctgctttccagccacatacctttacaggtgggacc
cattcatgtttgaatgtcgtccatgatccggttgagtccatctttgaccagtacctgtca
gacaccatgggctacctgctgggctgtttgaagaaggagaaagagaggacggctgctttc
caggccctggggctactggttgtggccgtcagggcagaaattcagccgtacctctccaag
atccttgagatcatcaaggcggccctgccaccgaaggactttgcgcacaagaggcagaag
accatgcaggtggatgccacagttttcacctgtatcagcatgctttccagagccatgggt
cccagcatccagccagacatcaaggagctgctggagcctatgctggctgtgggcctgagt
cctgcgctgacagcagtgctgtatgacctgagccgccaaatcccccagctgaagaaggac
attcaagacggtcttctgaagatgctttccctcgtgttgatgcacaagccgctgcgtcac
cctggcatgcccaaaggcctggctcaccagctggcctcgccaagcctcaccaacatccca
gaggcaagcgacgttggcagcatcacactggccctgcgcacactgggaagctttgaattt
gagggacactccctcacccagtttgtgcgccactgcgccgatcacttccttaatagtgaa
cacaaggagatccggatggaggcagctcggacctgctcacgtcttcttaccccctccatc
cacctgatcaacggccatgttgtcagccagacagctgtgcaggttgttgcagatgtgctc
agcaagctgctggttgttggaatcactgacccagatccagatattcgatactgtgtgttg
gcatctctcgacgagcgttttgacgctcacctcgctcaggctgagaacttgcaggcgcta
tttgtcgcactgaacgatgaggtgtttgagatcagagagctcgccatctgcacaattgga
cgcctcagcagcatgaaccctgcctttgtcatgcccttcctacgcaagatgctcatccag
atcttaacagagctggagcacagtggtgtcggcaggaacaaagagcagagtgctcgtatg
cttggccatctggtgtccaacgccccccgcctcatacggccgtatatggagcccatcctc
aaggctcttatcctcaagctgaaagacccagaccccaaccctggagtagtcattagtgtg
cttgcgacaattggcgagttggctcaggtgagtggcctggagatgaggaagtggatggac
gaactttttcctatcatcatggacatgctgcaagactcctcctcattggccaagcgacag
gtggcgctgtggacactgggccagcaggtggctagcacgggctacgtggtggagccttac
cgcaagtacccttcccttctggaggtgctgctcaacttcctcaagacggaacaaaaccag
gggatcaggagagaggctatccgtgttctgggtcttctcggtgctctggacccctacaag
cataaggtgaacatcgggatgattgaccaatcccgagacgcctccgctgtctcactctct
gagtccaagtccagtcaggactcagctgactacagcaccagtgagatgctagtgaacatg
ggcaacctgcccctggatgagttttacccggccgtggcaatcgtcaccctgatgcgcatc
ctgagggacccttcactctctaaccaccatactatggtggtccaggctgtcaccttcatc
tttaagtctcttggcctcaagtgtgtccagttccttccccaggtcatgcccactttcctc
aatgtcatccgggtctgtgatgccagcatccgagagttcctcttccagcagatgggaatg
gtggtgtgctttgtgaagatccacatccgcccctacatggacgacatcttcaccctcatc
agagagtactggacgccaaacaaccccatgcagaacaccatcatcctcctgattgagcag
attgtggtggcactgggcggagagttcaagctctatctgcctcagctcatcccacacatg
ctgcgtgtcttcatgcacgacaacagcaccgggcgcagtgtcactatcaagctgctgaac
gccatccagctgtttggtgccaacctagacgactacctccacttgctgctgcctcccatt
gtcaagctgtttgatgcccccgatgtgcccctgcaggcccgcaaggttgccttggagaca
cttgaccggctgacagagtccctggacttcacagactacgcctcacgcattatccacccg
attgttcggacacttgacagcacgcctgaactgcgctccacctctatggacaccctgtcc
tcgcttgtgttccagttgggcaagaaataccagatcttcatccccatggtgaacaaagtg
atgctgaaacacaggatcaaccaccagcgttatgacatactcatctgtcgcattgttaag
ggctatactctggctgaggaggaagaggaccctctaatctttcagcatcgccagcttcgc
ggtaaccaaggcgatgctctggtcagcgggccagtggaggcggggcctatgaaaaagctt
cacgtcagcactacggcacttcagaaggcttggggtgcggccaggaaggtgtccaaagat
gactggctggagtggctgaggcgcttgagtgtcgtcttgctcaaggagtcttcctcaccg
gccctgcgatcgtgctggtcactggctcagacttacattcccctcgccagggacctgttc
aacgcggccttcctgtcctgttggtctgagctgagtgaggaccagcaggatgagctcatc
cgcagcattgaattagctctcacctcccaggacatcgctgaggtcacacagactctactc
aacctggcagagttcatggaacacagtgacaagggccctttgcctctgagggatgataat
ggtattgtgctgcttggtgagagagctgccaagtgtcgtgcctacgccaaagccctgcat
tacaaagagctggagtttcagaaaggtccttctcctctcatcctggagtctcttatcagc
atcaacaataaactgcagcagccagaagctgcgtccggggtgctggagtacgccatgaaa
cattttggggagctggaaatccaagccacctggtatgagaagctgcatgagtgggaagat
gccctggtgtcatacgacaagaagatcgacttgaacaaagaggatccagagctcatcctg
ggcaggatgcgctgcttagaggccctgggagaatggggccagttgcaccagcagtgctgc
gaggagtggacgctggtgagcgaggaaacccaggccaagatggctcgtatggctgctgct
gccgcctggggtctagggcactgggacagcatggaggagtacacatgtatgatcccaaga
gacacgcacgatggcgctttttatagagcagtgctagccctgcatcaggacctcttctca
ttggcccagcagtgtattgacaaagcaagagacctcctggatgctgagctgacggccatg
gctggagagagctacagtcgagcttatggggccatggtatcttgccagatgctgtcagag
ctggaggaggtgatccagtacaagctggtgccagagaggagggacatcatcagggaaaca
tggtgggagaggcttcagggttgtcagcggattgtggaggactggcagaggatcctgatg
gtccgatcactggtcatcagcccccacgaggacatgaggacttggctgaagtacgccagc
ctctgtggcaagagtggacgtctggcactggcccataagaccctggtgctccttctgggt
gtcgacccctccaaacaacttgatcacccgctgcccacagcccacccacacgtcacctac
gcttacatgaagtacatgtggaagagtacccgcaagatcgatgcctttcagcacatgcag
cactttgtgcaagggatgcagcagcaggcccagcacgccatcgcggccgaggaccagcag
cacaagcaggaggtccacaaactgatggccagatgtttcctgaagctgggtgagtggcag
ctcagtctgcaggggatcaacgagagcaccatccccaaggttttgcagtattacagccat
tccactgagcatgaccgcaactggtacaaggcctggcatgcctgggcggtgatgaatttc
gaggcggtgctgcactacaaacaccagaaccaaggacgcgacgagaagaagaagctgagg
cacgccagcggtgccagcgccaatagcgaagccagcaacagcgacagcgaggtcgacagc
actgaccacagtcccgtgccctcgccggggcagaaaaaggtcaatgaggacctttccaag
acgttgctcttgtacacagttcctgctgttcagggtttcttccgctccatttccctgtcc
agaggaaataacctgcaggacacactcagggttctgactctttggtttgactatggtcat
tggcctgaagtgaatgaagccctggtggaaggcatcaagaccattcaaatcgacacctgg
ctccaggttatccctcagctcatcgcccgaatcgacaccccccgagccctggtggggcgc
ctcatccaccagctgctgacagacatcggacgatatcatccccaggctttgatctaccct
ctgactgtggcctccaagtccaccaccacagcgcgccacaatgctgctaacaagatcctg
aagaacatgtgtgaacactgcaacactttggttcagcaggccatgatggtgagtgaggag
cttatccgagtggccatcttatggcatgagatgtggcacgagggccttgaagaggcttca
cgtctttacttcggtgagcgcaatgtcaagggcatgtttgctgtgctggagcctctgcac
gccatgatggagaggggaccacagaccctcaaagagacctcttttaaccaggcttatggc
agggacttgatggaggctcaggactggtgcaggaagtacatgcgctctggaaacgttaaa
gacctgacccaggcctgggacctctactaccatgtgttcagacgcatctccaaacagctg
ccacagctgacctccctggagctacaatatgtgtctccaaagctgctgatgtgccgggac
ctggagctggctgtaccgggcacttatgaccccaaccagcctatcatccgcatccagtcc
atcgccccctccctgcaggtcatcacctccaagcagcgcccacgcaaactcaccatcatg
ggcagcaatggccacgagttcatgttcctgttgaagggccacgaggacctgaggcaggac
gagagagtcatgcagctgttcggtttagtcaacactctgctggccaacgaccccgcgtcc
ttgcgcaagaacctcagcattcagcgctatgcggtgatccccctgtccactaactcgggc
ctgattggctgggtaccccactgtgacaccctgcatgccctcatcagagactacagagag
aagaaaaagattttgctcaacatcgaacatcgcatcatgctgaggatggccccggactac
gaccacctgacactgatggagaaggtcgaggtgttcgagcacgccgtcaacaacacggcc
ggagacgacctggccaagcttttgtggctcaagagcccctcctccgaggtgtggttcgac
aggaggaccaattacacccgctccctggctgtgatgtcaatggtgggctacatcctggga
ctgggtgacaggcatccgtccaacctgatgttagaccggttaagcggcaagatcctccac
attgactttggagactgttttgaggtggccatgaccagagagaagttccctgagaagatc
ccgttccgactgacgaggatgttgaccaacgccatggaggtgacgggcttggacggtaac
taccgcatcacctgccacacggtgatggaggtgctgagggagcaccgggacagcgtcatg
gccgtgctggaggccttcgtctacgacccgctgctcaactggaggctcatggacacaaac
accaaaggcaacaagcgttcccgcaccaggaccgactcgtacactgctggacagtcagtg
gaggctctcgagggcatagatcttggagagagcacacacaagaaaccagggaccacagtg
cctgaatccattcactccttcattggagacggcttggtgcaacctgaagcactcaacaag
aaagccattcagattatcaaccgagtgagagacaaactcacaggtcgagacttctctcac
gatgagacactggatgtgccggtacaagtagacctcctcatcaagcaagccacatcacac
gaaaacctgtgccagtgctacatcggatggtgtccattttggtga

DBGET integrated database retrieval system