KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111656484
Entry
111656484         CDS       T06058                                 

Definition
(RefSeq) leptin-B-like
  KO
K05424  leptin
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal04060  Cytokine-cytokine receptor interaction
slal04080  Neuroactive ligand-receptor interaction
slal04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:slal00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    111656484
   04060 Cytokine-cytokine receptor interaction
    111656484
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    111656484
Cytokines and growth factors [BR:slal04052]
 Cytokines
  CSF and other factors
   111656484
SSDB
Motif
Pfam: Leptin
Other DBs
NCBI-GeneID: 111656484
NCBI-ProteinID: XP_023263985
LinkDB
Position
Unknown
AA seq 156 aa
MRILLALLYVYLVAAPGCTSLPRKGDSVRNTIHNIMNIAQITLVHIKKLRTKLPVSPQIE
VTSPSIDGLISISHDLGLLDNELQSTDLLSQIQADVSSLEGSVRSLALTMDCTIQARPSE
ETSDSLFPDSHLYLTLIKVQRYLEKLLLNKDKLKVC
NT seq 471 nt   +upstreamnt  +downstreamnt
atgcgcatccttctggcccttctatatgtttatcttgtggcagctcctggttgcacaagt
cttcccagaaagggagactccgtgagaaataccatccacaacataatgaatatcgctcag
ataactctggtccacattaagaaactaaggacaaagttgccagtatccccacagatagaa
gtcaccagtccttccattgacggacttatcagtatcagccatgaccttggacttttggac
aatgaactacagagcacagatctcctcagccagatccaggccgatgtctccagcttggag
ggaagtgtgcgctccctcgctctgacaatggactgtaccatccaggccagacccagtgaa
gagaccagtgacagtttgttcccagacagtcacctttacctgactctgatcaaggtgcag
cgctatctggagaaattgcttctcaacaaggacaaactcaaggtctgttaa

DBGET integrated database retrieval system