KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111657717
Entry
111657717         CDS       T06058                                 

Gene name
socs3
Definition
(RefSeq) suppressor of cytokine signaling 3
  KO
K04696  suppressor of cytokine signaling 3
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal04120  Ubiquitin mediated proteolysis
slal04910  Insulin signaling pathway
slal04920  Adipocytokine signaling pathway
slal05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:slal00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    111657717 (socs3)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    111657717 (socs3)
   04920 Adipocytokine signaling pathway
    111657717 (socs3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    111657717 (socs3)
Ubiquitin system [BR:slal04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     111657717 (socs3)
SSDB
Motif
Pfam: SH2 SOCS_box SH2_2
Other DBs
NCBI-GeneID: 111657717
NCBI-ProteinID: XP_023265777
LinkDB
Position
Unknown
AA seq 205 aa
MVTHSKFDSAMSSSLLDSNMRLPYRYKTFTSKTQYQMILTTLQKLQESGFYWGAITGKEA
NAMLAAETTGTFLIRDSSDNRHLFTLSVKTASGTKNLRIQCDTASFYLQTDPKNIQSVPH
FDCVLKLVHYYMPQSKGNTRSGNMYYIYSGGEKIPLELIKPLSCSLSTLQHLCRKTVNGH
LDISSKRDQLPHPLKEFLQEYDAPI
NT seq 618 nt   +upstreamnt  +downstreamnt
atggtaactcacagcaagtttgactccgcaatgagcagcagcctcttggactccaacatg
cggctgccttaccgttacaagactttcacctccaagacgcagtaccagatgatcctcacc
acgctccaaaagctccaggagagtggcttctactggggtgccatcactgggaaggaggcc
aacgccatgctggcagccgagaccaccggcaccttcctcatccgtgacagctccgacaac
cgtcacctgttcaccctcagtgttaagacggcgtcaggcaccaagaatctgcggatccag
tgcgacactgcgtctttttacctgcaaacagaccctaagaacattcagtccgttccccac
ttcgactgcgtcctgaagctggtgcattactacatgccacagagcaaggggaacactcgc
agtgggaatatgtactacatttactctggaggagagaaaatccccctggagctcatcaaa
cctctctcctgcagcttgtccaccttgcagcacctgtgcaggaaaacagtcaacgggcat
ttggacatttcctctaaaagagatcagcttcctcatcctcttaaggagttcctccaggag
tatgatgctcctatctag

KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111673508
Entry
111673508         CDS       T06058                                 

Definition
(RefSeq) suppressor of cytokine signaling 3-like
  KO
K04696  suppressor of cytokine signaling 3
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal04120  Ubiquitin mediated proteolysis
slal04910  Insulin signaling pathway
slal04920  Adipocytokine signaling pathway
slal05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:slal00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    111673508
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    111673508
   04920 Adipocytokine signaling pathway
    111673508
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    111673508
Ubiquitin system [BR:slal04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     111673508
SSDB
Motif
Pfam: SH2 SOCS_box RMMBL
Other DBs
NCBI-GeneID: 111673508
NCBI-ProteinID: XP_023287047
LinkDB
Position
Unknown
AA seq 228 aa
MVTYGGRNAFAMSSVPPPEGRVQGSNFTPHHYKPFSSHAHYQQVMRALRKLQESGFYWGA
VGGREASSLLRSEPPGTFLIRDSSDHHHFFTLSVQTARGTKNLRIHSEGGGFFLQPDPQS
SQEPPQFDCVLKLIAHYMGKGPEAGRSREGACGGNSRGAEMKGRNVYLIHTGGERIPLEL
RRPLSTSLSSLQHMCRRTLNNQGLGGSERAEQLPHTLRDFLEEYDAPI
NT seq 687 nt   +upstreamnt  +downstreamnt
atggtaacctacggcggacgcaacgccttcgccatgagcagcgtgccccctccggagggc
agggttcaggggtccaactttaccccacatcactacaagcccttcagttcgcacgcacac
taccaacaggtgatgcgtgcattgcgtaagctccaggagagtgggttttactggggggct
gtgggaggtcgggaggccagctccctgctgcgctctgaaccgcctggcaccttcctgatc
cgagactcctcggaccaccaccacttcttcaccctgtctgtccagacggctcgaggaacc
aagaacctgcgaattcacagtgagggaggcggcttcttcttacagccagacccccaaagc
tcccaagagcccccacagtttgattgcgtgctgaaactcatagcgcactacatggggaaa
gggccagaggctggaaggagcagagaaggggcgtgcgggggcaactcaagaggggcagaa
atgaaagggcgcaacgtttatctgatccacaccggtggagagaggatccccctggagttg
cggcgacccctctcaacctctctctcatccttgcagcacatgtgcaggaggaccttgaac
aaccaaggcctgggggggtcggagagagcagagcagctcccgcacacacttagagacttc
ctggaggagtacgacgctcccatatga

DBGET integrated database retrieval system