KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111657911
Entry
111657911         CDS       T06058                                 

Definition
(RefSeq) tumor necrosis factor receptor superfamily member 1B-like
  KO
K05141  tumor necrosis factor receptor superfamily member 1B
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal04060  Cytokine-cytokine receptor interaction
slal04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:slal00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111657911
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    111657911
Cytokine receptors [BR:slal04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   111657911
CD molecules [BR:slal04090]
 Proteins
  111657911
SSDB
Motif
Pfam: TNFR_c6
Other DBs
NCBI-GeneID: 111657911
NCBI-ProteinID: XP_023266018
LinkDB
Position
Unknown
AA seq 486 aa
MKEILVLLVLLSAETAKVCSQPYTVDSNGNCRNSTREYMPDESNLCCKKCRPGERLIEDC
TETTESVCAKCEPGQYMESWNFAQNCFSCEKCKTRNGVEYAQNCSSTTRARCKCMPGMYC
VIGFNSPYCKECARYIPCKVGHGVSLPGTANSNVRCEQCPVGTFSDTISLTDRCRPHTNC
HGNAVVRKGNTTSDTLCEHQGVTTAQIPKTLKADDTGFVVMTASTMRSTVLEVSDSMLPV
SKEVFNRSTKSPPPLTAPDITLVAVSAGIIGSILLFIIIILVCFYKHFWKKDTAEFPLKV
DANGNCESSDKIIPGYLGETQLISLTHSPEQQGLLGKGEACSDHSQCNNYTEALTRTDGC
SSHDSIGPLQSTVALDDSCSALSEPMTLISNTEPVTPQPSVPAQHSSQPTSPQIISPVTT
SPHVNVNITFHIGNGSGGTPSVIPTNLKEADCQLPFGEEEKSYSIPQQEDGKHSQMSVQD
SGSYSV
NT seq 1461 nt   +upstreamnt  +downstreamnt
atgaaggaaatacttgtactactggttctgttgagtgccgaaactgccaaggtgtgctct
cagccctatacggtggactcaaatggaaactgtcgcaactcaacaagagaatacatgcct
gatgaatctaacctgtgttgcaagaaatgccgccctggtgagcgactgatagaggactgc
actgaaactactgagagtgtgtgtgcaaagtgtgaaccaggccagtacatggagagctgg
aactttgcccaaaactgcttctcctgtgaaaaatgcaaaacaagaaatggtgtagagtac
gcccagaactgctcctctaccacaagggccaggtgtaagtgcatgcctgggatgtattgt
gtgataggatttaacagcccatactgcaaagaatgtgcgaggtacatcccatgcaaagtt
ggtcatggagtgtctctgccagggacggcaaactcaaatgtgaggtgtgaacagtgccca
gtcgggacgttctctgacacaatctccctcacggaccgctgtcggcctcatacaaactgt
catgggaatgctgttgtcagaaaaggcaacactacctcggacaccttgtgtgaacatcag
ggtgttacaactgcacagattccaaaaacattaaaagcggatgacactggctttgtagtc
atgactgcaagtacaatgaggagcacagtcttagaagtctccgactccatgctgcctgtc
tcaaaggaagtattcaaccgttcaacaaaaagcccaccgccactcacagcacctgacatt
actctggttgctgtcagtgctggaatcattggatccattttgcttttcatcattatcatt
ttggtgtgtttttacaaacatttctggaagaaagacactgcagaatttcctcttaaagtg
gatgcaaatggaaactgtgaaagtagtgataaaatcattccgggttatttgggggaaact
caactgatttcattgactcactcaccagaacaacagggtcttctgggaaaaggggaagct
tgcagtgaccacagccagtgcaataactatactgaagctttaacccgaacagacggctgc
agcagccatgactccatcggccctttacaatcaactgtcgcccttgacgattcatgctct
gctctgtcagagccaatgactttaatttccaacacagaacctgtcacacctcagcccagt
gtccctgcacagcactcctctcagcctaccagcccgcagatcatcagccctgtgaccacc
agtcctcatgtcaatgtcaatatcactttccacataggaaacgggtctggcgggacgcca
tctgttattcccacaaacttgaaggaagcagactgtcaactcccctttggagaggaggag
aaatcctatagcatcccacagcaagaagatggcaaacattcgcaaatgtcagtacaggac
agtggaagttacagtgtatga

DBGET integrated database retrieval system