KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111658709
Entry
111658709         CDS       T06058                                 

Definition
(RefSeq) carnitine O-palmitoyltransferase 1, liver isoform-like isoform X1
  KO
K08765  carnitine O-palmitoyltransferase 1, liver isoform [EC:2.3.1.21]
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal00071  Fatty acid degradation
slal01212  Fatty acid metabolism
slal03320  PPAR signaling pathway
slal04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:slal00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    111658709
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    111658709
   03320 PPAR signaling pathway
    111658709
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:slal03029]
    111658709
Enzymes [BR:slal01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     111658709
Mitochondrial biogenesis [BR:slal03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    111658709
SSDB
Motif
Pfam: Carn_acyltransf CPT_N
Other DBs
NCBI-GeneID: 111658709
NCBI-ProteinID: XP_023267105
LinkDB
Position
Unknown
AA seq 785 aa
MAEAHQAVAFQFTVTPEGIDLQLSHQALTEIYLSGVRSWKKRIIRLKNSVITGVYPASPS
SWLFVVIAILATMYTRSDPSMGLIAKIQEHLPVSQSMSTQCQAVVSAVLFSTMLWLLLIF
TMRLCLKQLLSYHRWMFEQHGKMSNTTKVWVALVRIFSGRKPLLYSYQGSLPNLPLPTIK
DTVKRYLESVRPLMDDTQYERMTKLAAEFESSLGNRLHWYLKLKALWASNYVSDWWEEYV
YLRGRSPIMVNSNYYGMDFLYVTPTPIQSARAGNSIHAFFLYRRKLNKEEIKPSRIPGTV
IPLCAAQCERIFNTTRTPGEETDTVQHWQDSDYVVAYHRGRYFRLRVYQAGRLLSPREIE
FQVQRILDDPSPPSKGEAKLGALTAGDRIPWAKARTKYFSSGVNKRSLDCIERAAFFVTL
DDDEQGMMGDDPAASLDRYAKSLLHGKCYDRWFDKSFSVVYYKNGKNGINAEHSWADAPV
LAHLWEYTLATDSFQLGYNAEGHCKGDVDSSLPRPQKLNWEILPECEEQISQSLAVAQAL
ADDVDFHVFSFRDFGKGKVKKCRVSPDAFIQMALQLAYYRDRRTFCLTYEASMTRLFREG
RTETVRSCTNESSAFVRALDGGEAADVCRRLFRAALDKHQNLYRMAMTGAGIDRHLFCLY
VVSKYLGVESPFLKEVLSEPWRLSTSQTPVQQVELFDLVNHPEYISCGGGFGPVADDGYG
VSYCIVGDNLINFHISCKHSCPDTDAHKFGAQIRKALHDLIQMLSPNQKEPNKTEESRPE
VKKDL
NT seq 2358 nt   +upstreamnt  +downstreamnt
atggcagaggcccaccaggcagtggccttccagttcacagtcaccccagagggtatcgat
ctgcagctgtcccaccaggccctaactgagatctacctctctggtgtgcgctcctggaag
aagcgtatcatcagactcaagaacagtgtgataacgggggtatatcctgctagcccttcc
tcctggctttttgtggtcatagcaatcctggctactatgtacactcgctccgacccctcc
atgggcctcatagccaagatacaggagcacctgccagtcagccagtcaatgagtacgcag
tgccaggcagtggtgtcagcagtgctcttcagcaccatgctatggctcttgctcatcttc
accatgcgactgtgtctgaagcagcttctctcttaccaccgctggatgttcgagcaacac
ggcaagatgtccaacactaccaaagtctgggtggcgctggtgcggatcttttctggcaga
aagcctctactctacagctaccagggttcgttgccaaacttgcctttgcccaccatcaag
gacacagtcaagaggtacttggaatccgtgcgtccgctgatggatgatacgcagtatgaa
cgtatgaccaaactggccgcagagttcgagagcagcctcggtaaccgcctgcattggtac
ctcaaactcaaagctctctgggcatccaactacgttagtgactggtgggaagaatacgtc
tacctacggggacgaagcccaatcatggtcaacagtaactactatggcatggacttcttg
tatgtgacacccacacccatccagtcagccagagcaggcaacagcatacatgcattcttc
ctgtaccgtcgcaaactcaacaaagaagaaattaaacctagtcgtataccaggcactgtc
attcctctgtgtgcagcacagtgtgagaggatattcaacaccacacgcactcctggagag
gagaccgacactgtgcaacactggcaggacagcgactatgtagtggcataccacaggggt
cgctactttcgtctgagggtgtaccaggcaggcagactcctgtcacccagggagattgaa
ttccaggttcagaggatcctcgatgacccttcacctccttccaaaggagaggccaaactc
ggggctctgactgctggagacagaattccatgggctaaagccagaactaagtatttcagc
agtggggtcaataaacgctctctggactgcattgagagagccgccttcttcgtgaccctg
gatgatgatgaacagggcatgatgggagatgaccctgccgccagtctagatcgctatgct
aagtccttgttgcatgggaaatgttatgacaggtggtttgacaagtccttctcagttgtt
tactacaagaatggaaagaatggcataaacgcagagcactcgtgggctgatgcaccagtg
ttggcacacttatgggagtacaccctggccactgacagtttccagctgggttacaatgct
gagggtcactgcaaaggagatgtggattcatcattaccacgaccacagaagctgaactgg
gaaatccttccagaatgtgaggagcagatctcgcagtcgctggcagtggcccaggccctg
gctgatgacgtagacttccacgttttctccttcagagacttcggcaaaggaaaggtcaag
aagtgtcgcgtcagtccagatgccttcatccaaatggctcttcagctggcctactacagg
gaccggaggacgttctgcttgacgtacgaagcctccatgacccgtttgttcagggagggc
aggactgagactgttcgctcctgtaccaatgagagcagtgccttcgtccgagcgctggat
ggtggagaggcagcagatgtgtgcaggcgtttgttccgtgcagcgttagacaagcaccaa
aatctgtatcgcatggccatgactggagctggcatcgacagacacctcttttgcctctac
gtggtttccaaataccttggagtggagtctcctttcttgaaagaggtgctgtctgagccc
tggcggctgtccaccagtcagactccagtccagcaggtggagctgtttgacctggtcaac
cacccagagtacatctcctgcggagggggctttggtccggtggctgatgatggttatggg
gtgtcctactgcattgtgggtgacaacctgattaacttccacatctcgtgcaagcactcc
tgtccagacactgatgcccataagtttggtgctcagatcagaaaagccctgcacgacctg
atacagatgctgagccccaaccaaaaagagcccaacaaaacagaggagagtcggcctgag
gtcaagaaagatctgtag

KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111661771
Entry
111661771         CDS       T06058                                 

Definition
(RefSeq) carnitine O-palmitoyltransferase 1, liver isoform-like isoform X1
  KO
K08765  carnitine O-palmitoyltransferase 1, liver isoform [EC:2.3.1.21]
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal00071  Fatty acid degradation
slal01212  Fatty acid metabolism
slal03320  PPAR signaling pathway
slal04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:slal00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    111661771
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    111661771
   03320 PPAR signaling pathway
    111661771
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:slal03029]
    111661771
Enzymes [BR:slal01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     111661771
Mitochondrial biogenesis [BR:slal03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    111661771
SSDB
Motif
Pfam: Carn_acyltransf CPT_N
Other DBs
NCBI-GeneID: 111661771
NCBI-ProteinID: XP_023271201
LinkDB
Position
Unknown
AA seq 772 aa
MAEAHQAVAFQFTVTPDGIDLQLCHEALRQIYLSGLHSWKKRFIRFKNGVMTGVYPGSPG
GFMVVVVSYMSYNKYNQLDPSLGLIAKLGQHIPISRYMSTDSQRIVGGVLVGTGLWVTII
MIMRNVLKCLLSWHGWMYARHGSVSWSTRLWMLLVKVFSGRKPMLYSFQNSLPRLPVPTV
KDTCRRYLDSVRPLMDDEQYERMKGLTKDFEKNLGPRLQWYLKLKSWWASNYVSDWWEEY
IYLRGRGPIMVNSNYYAMDFLYVFPTSIQAARAGNAIHAIMLYRRKLDRAQIKPLYLLAN
KVPLCSAQWERMFNTTRIPGLETDTLQHMNESKHIAVYHKGRFYKVWMFYDGRLLLPREI
EQQMERILSDKSEPLPAEEKLAALTAGDRTPWAKARETFFGRGKNKQSLDAIEKAAFFVT
LDDTEQRYEEDNPVKSLDSYAKSLLHGKCYDRWFDKSFNLIVFKNGTMGLNAEHSWADAP
IIGHLWEHVLSMDPIKLGYTEEGHCCGEPHPNLPGPQRLQWDLTAECQETIQSSLTLARN
LADDVDCHIFPFTNFGKGLIKKCRTSPDAFIQIALQLAHYRDKGKFCLTYEASMTRLFRE
GRTETVRSCTMETCTFVRSMIRDETREERLKLLKLAAEKHQNMYRLAMTGDGIDRHLFCL
YVVSKYLGEDSAFLKEVLSEPWRLSTSQTPLQQVELFDLVRYPEYVSSGGGFGPVADDGY
GVSYIIVGENLINFHISSKHSSPETDSHRFGANIKQAMLDILDLFQLDKKAK
NT seq 2319 nt   +upstreamnt  +downstreamnt
atggcagaagctcaccaggcggtggcctttcagttcaccgtcacccctgatggcatcgac
ctacagctgtgccatgaggctctacgccagatctacctctctggcctccactcctggaag
aaaaggttcattcgcttcaagaatggggtaatgactggtgtgtacccgggcagccctggt
gggttcatggtagtggttgtgtcctacatgtcctacaataaatataatcaactggatcct
tctctggggttgattgccaagctgggccaacacatacctattagccgatatatgtccaca
gacagccagaggatagttggaggagtgttggtgggcacgggcctgtgggtcaccataatc
atgataatgaggaatgtcctaaagtgcctgttgtcgtggcatggctggatgtatgcacgc
catggctctgtgtcctggtctactcgtctgtggatgttattagtgaaggtgttctctggc
aggaagccaatgctctacagtttccagaactccctgccgcggcttcctgttcccactgtc
aaggacacctgcagaaggtacctggattctgtgcgcccactgatggatgatgagcagtat
gaaaggatgaagggcttgactaaagactttgagaagaacctgggacctaggttgcagtgg
tacctcaaactcaagtcgtggtgggcctcaaactatgtcagtgactggtgggaagagtat
atttacctcagaggccgtgggcccatcatggtcaacagcaactattatgccatggatttc
ctgtacgtgttccccacctccatccaggctgccagggcaggtaatgccatccatgccatc
atgctctacaggagaaaacttgacagagcccagatcaaaccactttacttgctggcgaac
aaggttcctctgtgttcggctcagtgggagcggatgtttaacaccacccgcatccctggt
ttggagacagacacacttcagcacatgaatgagagcaaacacatagctgtgtaccacaag
ggccgtttctacaaggtgtggatgttttatgacgggcgcctgctgttgccacgggagata
gagcagcagatggagaggatcttgtcagacaagtcggagcccttgccagcagaggaaaaa
ctagctgcacttactgcaggggacaggaccccatgggcaaaggcacgtgaaaccttcttc
ggccgtggtaagaacaagcaatctctggacgccattgagaaagcggccttctttgtaacc
cttgatgacaccgagcagcgctacgaggaagacaatccagtcaagtctctggacagttat
gccaagtccctgctccatggaaagtgctatgacaggtggtttgacaaatcctttaacctg
atagtgttcaagaacggcaccatggggctgaacgcagagcattcctgggcagatgctcca
atcattggtcatttgtgggagcatgtgctctccatggaccctattaagctgggatatact
gaggaaggtcactgctgtggggagccccaccccaacctgccaggtcctcagaggctgcag
tgggatcttactgctgagtgccaggaaaccatccagagctctctgacattagccaggaat
ctggcagatgatgtggactgtcacattttccccttcactaactttggcaagggtctgatt
aagaagtgccgcaccagtcccgatgccttcatccagatcgctctacagctggcccattac
agggacaaagggaagttctgcctgacatacgaagcctccatgacgcgtttgttccgtgag
ggccgaacagaaactgtgcgctcctgcacgatggaaacatgtacctttgttcgttccatg
atcagagatgagacaagagaagagcgcctcaagttgctcaaactagcagcagagaagcat
caaaacatgtaccgcctggctatgacgggagacggcattgatcgccaccttttctgtctc
tatgtggtttccaaatatttaggagaagactcagcttttctcaaagaggtgctgtccgag
ccatggaggctgtccaccagtcagactcctctgcagcaggttgagctgtttgacctggtc
agatacccagagtatgtgtcctctgggggtggatttggtccggtggctgatgatggttat
ggtgtctcttacatcattgttggtgagaacctcatcaacttccacatttccagcaaacac
tcaagcccagaaactgactcgcaccgttttggtgccaacatcaaacaggccatgctggat
attctggatctcttccagcttgacaagaaagccaagtga

KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111662452
Entry
111662452         CDS       T06058                                 

Definition
(RefSeq) carnitine O-palmitoyltransferase 1, liver isoform-like
  KO
K08765  carnitine O-palmitoyltransferase 1, liver isoform [EC:2.3.1.21]
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal00071  Fatty acid degradation
slal01212  Fatty acid metabolism
slal03320  PPAR signaling pathway
slal04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:slal00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    111662452
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    111662452
   03320 PPAR signaling pathway
    111662452
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:slal03029]
    111662452
Enzymes [BR:slal01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     111662452
Mitochondrial biogenesis [BR:slal03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    111662452
SSDB
Motif
Pfam: Carn_acyltransf CPT_N
Other DBs
NCBI-GeneID: 111662452
NCBI-ProteinID: XP_023272080
LinkDB
Position
Unknown
AA seq 788 aa
MAEAHQAVAFQFTITPEGIDLQLSYQALNQIYLSGVRSWKKRVSRIRNRVIKGVYPASPS
SWLFVVIAILATMYMRSDPSMGLIAKIQQHLPLSLHVSLSAQGQTMVSALVFSTLLWLSL
ILALRFCLKLLLSYHQWMFEQHGRVSNTTKVWVTLLRLLSSRKPLLYSYQTSLPHLPVPA
IKDTLSRYLESVHPLLTDPEFKRMTELGNQFESSLGNRLQRYLKLKALWATNYVSDWWEE
YIYLRSRSPIMVNSNYYGMDFLYVTPTPVQAARAGNTITALLLYRRKVNREELKPSRVPG
TVIPLCAAQCERMFNTTRTPGAETDVLQHWQDSEFVAVYHKGRFFRLWVYRAGRLLSPRE
IEYQVQRILDDSSPPQPGEEKLGALTAGDRIPWSRMRKQYFSSGVNKRSLDAIERAAFFV
TLDDEEQGMRGEDPAGNLDRYAKSLLHGKCYDRWFDKSFSIVIYKNGKNGLNAEHSWADA
PTVAHLWEYTLATDAFQLGYTEDGHCKGEVDRSLPYPQRLPWDIPSEVQAEAQSSLTVAQ
ALADDVDCHVFPFSVFGKGRIKKLRISPDAFIQIGLQLAYYRDRGGFCLTYEASMTRLFR
EGRTETVRSCSNESSAFVKALEGGEAAEQCRRLFRLASERHQNLYRMAMTGAGIDRHLFC
LYVVSKYLGVESPFLKEVLSEPWRLSTSQTPVQQMELFDLKNHPDFVSLGGGFGPVADDG
YGVSYIIVGEDMINFHVSSKYSCGETDSHRFGSQISKALQDIMTLLTPDTKTSSSSKSTA
QPQSKKLL
NT seq 2367 nt   +upstreamnt  +downstreamnt
atggcagaggcccaccaggccgtggcgttccagttcaccataacaccagagggtattgac
ctgcagctgtcctaccaggccctgaaccagatctacctgtccggagtccgatcatggaag
aaacgagtcagccgcataaggaacagggtgattaagggagtatacccagccagcccttcc
tcttggctctttgtcgtcatagcgatcctggccaccatgtacatgcgctcagatcccagc
atggggctcatcgccaagatacagcaacacctgccactaagtctccatgtctccctcagt
gcccagggtcagactatggtgtcagcgctggtcttcagcactctgctgtggctctccctc
atcctcgcgctcaggttctgcctcaagctgctgctgtcctatcaccagtggatgttcgaa
caacacggccgtgtttccaacaccactaaagtctgggtgactctgctaaggttattatca
agcaggaagcctctgctctacagctatcagacctctctccctcacctgcctgttcctgcc
atcaaagacacactgagcaggtacctggagtctgttcaccctctgttgactgatcccgag
tttaaacgaatgactgaactgggcaatcagtttgagtccagcctgggaaaccgtctccag
cgctacttgaaactgaaagctctgtgggccacgaactatgtgagcgactggtgggaggaa
tacatctacttgagaagccgaagtcctatcatggtcaacagtaactactatggcatggac
tttctgtatgtgaccccgaccccggtgcaggctgccagagcaggcaacactataactgcc
ctgctgctctaccgccgcaaggtaaaccgggaggaactcaaaccgagtcgtgttccaggt
actgtcatccctctgtgtgctgctcagtgtgagaggatgttcaacacaacacgcactcca
ggagctgagactgacgtgctacagcactggcaggacagtgagtttgtggcggtgtaccac
aaggggcgctttttccgcctgtgggtgtaccgggcaggccgactgctgtctcccagggag
atcgagtaccaggtccagaggattttggatgactcctcacccccgcaacccggagaggaa
aaactgggggctctcactgctggagacaggattccttggtctcgaatgaggaagcagtac
ttcagctccggcgtcaacaagcgatcgctggatgctatcgagagggcagccttctttgtg
accttggatgatgaagagcaaggcatgaggggagaggacccagcaggaaacctggaccgg
tacgccaagtccctgctccatgggaaatgttatgacaggtggtttgataaatcattctcc
attgtgatctacaagaatgggaagaatgggctgaatgcagagcactcctgggctgacgca
ccgaccgtggctcacctttgggagtacaccctggccacagatgccttccagctcggctac
actgaggacgggcactgtaaaggcgaggtggaccgctcactgccctaccctcagaggctt
ccctgggacatcccctcagaggttcaggctgaggcgcagagttccctgactgttgcgcag
gccctggctgatgatgtggactgccacgtgttccccttcagcgtgtttggtaaaggacgc
atcaagaagcttcgcatcagcccagacgcattcatacagatcggcttacagctggcatac
tacagggatcgtggtggtttctgtctgacttacgaggcgtcgatgacccgtctgttcaga
gagggccggacggagactgtgcgatcatgctccaacgaaagctctgcctttgtcaaagct
ctagagggtggggaggcggcggagcagtgcaggcgtctcttccgactggcttctgagagg
caccagaatctttatcggatggctatgacgggagctggaatcgacagacacctcttctgc
ctgtatgtggtgtccaagtacctgggggtggagtcaccgttccttaaagaggttttgtca
gagccctggcgtctctccaccagtcagacgccggttcagcagatggagctgtttgacctg
aagaaccatcccgactttgtgtcgctgggcggagggttcggacctgtcgctgatgatggc
tacggggtgtcatacatcatcgtgggtgaggatatgatcaacttccatgtgtcatccaaa
tactcctgcggcgagactgactcgcacagattcggctctcagataagcaaagctctccaa
gacatcatgactctcctcactcctgacaccaaaacctcctcgtcctccaagtccacggcc
caacctcagtccaagaaactcctctga

KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111671246
Entry
111671246         CDS       T06058                                 

Definition
(RefSeq) carnitine O-palmitoyltransferase 1, liver isoform-like
  KO
K08765  carnitine O-palmitoyltransferase 1, liver isoform [EC:2.3.1.21]
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal00071  Fatty acid degradation
slal01212  Fatty acid metabolism
slal03320  PPAR signaling pathway
slal04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:slal00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    111671246
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    111671246
   03320 PPAR signaling pathway
    111671246
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:slal03029]
    111671246
Enzymes [BR:slal01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     111671246
Mitochondrial biogenesis [BR:slal03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    111671246
SSDB
Motif
Pfam: Carn_acyltransf CPT_N
Other DBs
NCBI-GeneID: 111671246
NCBI-ProteinID: XP_023284092
LinkDB
Position
Unknown
AA seq 787 aa
MAEAHQAVGFQFTVRPDGVDLKLSQEVIKNIYLSGVTAWKKKAIQFKNGVLAGVYPASPS
SWLIVVIAMMSSLYIRIDPSLGMIDAIKDNLPQRDYMSVQTRAVLSAILFATGLWLFLIY
LLRYTLKALLSYHGWIFESHGKMSTSTKVWLSLVKMFSGRRPLLYSFQASLPRLPVPSVD
DTIHRYLESVRPLLDGEQYNQMEILANDFKDSKATQLQRYLILKSWWATNYVSDWWEEYI
YLRGRSPIMVNSNFYIMDLLYMTPTHRQAARAGNVVHAMLQYRRKLERGEHAPLRAVGTV
PMCSTQMERMFNTTRIPGIETDIVQHLTDRKHLIVYHKGRFFQVWLYTGGRHLLPSELET
QFQKILNDTSEPQPGELKLAALTAGNRVPWARARIKYFSLGVNKVSLDAIESAAFVLTLD
DEPQGYDSAKTNSLDSYAKSLLHGKCYDRWFDKSFTLISYPNGKMGINAEHSWADAPVVG
HMWEYVLATDCFHLGYTEEGHCKGDVNKGLPHPTRLQWQIPKECQEIIGTSYLSAKQIAD
DVDFHGYLFSEFGKGLIKKCKTSPDAFIQLALQLAQFRDQGVFCLTYESSMTRMFRDGRT
ETVRSCTSEAVAFVRAMEDASGTNVQRLALFRRAADKHQNMYRLAMTGSGIDRHLFCLYI
VSKYLGVDSPFLEKVLSEPWKLSTSQTPQQQLNLVDINKFPKYVGAGGGFGPVADDGYGV
SYIIVGENLITFHISSKFSSPDTDSCRFGQHIRKAMLDIQGLFKPENDKKMVEHGKLVQL
ENGKKHI
NT seq 2364 nt   +upstreamnt  +downstreamnt
atggctgaggcgcatcaggcggtgggcttccagttcaccgtgcgccctgatggtgtggac
cttaagctgagtcaagaggtcatcaaaaacatctacctatcaggagtgacagcatggaag
aagaaggccatacaattcaagaatggagtattggctggagtctatccagccagtccgtcc
agctggctgatagttgtgattgccatgatgagttccttgtatatacgcatagacccctct
ctaggaatgattgacgccatcaaggataacctaccacaaagagactatatgtcagtgcag
acccgagcggtgctgagtgccatcctctttgccactggtctgtggctgttcctcatctac
cttttgagatacactctcaaagctctgctctcctaccatggctggatttttgaatcccat
ggaaaaatgagcacgtctaccaaagtgtggctgagcctggtgaagatgttctctggacgc
agaccgctgctttacagtttccaggcgtctttacccaggctccctgtgcccagtgtggat
gatacaattcacaggtacctagagtcagttcgtcctctgctggacggtgagcagtataac
caaatggagattttggccaatgactttaaagattccaaggcaacccagctgcagagatac
ttaatcctaaaatcctggtgggcaacaaattatgtaagtgactggtgggaggagtacatc
tacctcagggggaggagtcctatcatggtgaacagtaacttctacataatggacctcttg
tacatgaccccaacacaccgacaggctgcgcgggcggggaatgtggtccatgccatgctg
cagtacagacgcaaactggaacgtggtgaacatgcaccgctgagggctgtggggactgtt
cctatgtgttctactcagatggagaggatgtttaacaccactcgcatccccggcattgaa
acagatattgtgcagcacctgaccgaccgtaagcacctgattgtctaccacaagggccgg
ttcttccaagtgtggctgtacactggagggcgccacctcttacccagtgaacttgagact
cagtttcaaaagatcctcaatgatacatcggaaccccagccgggagaactcaaattagct
gccctgactgcaggaaacagagttccatgggctcgggctcggattaagtatttcagcctg
ggagtaaacaaagtgtccctggatgccattgagtcagctgccttcgtcctgacactggat
gatgagccgcagggttatgactctgcaaagaccaattcactcgatagttacgccaaatcc
ctgctccatggaaaatgttacgacaggtggtttgacaagtctttcaccttgatctcttat
ccaaatggaaaaatggggataaatgctgaacattcttgggctgatgcaccagttgtagga
catatgtgggagtatgtccttgcaacagactgcttccatcttggctacacagaagaggga
cactgtaaaggggatgtgaacaaaggcctgcctcatcccactcgactgcagtggcagatt
ccaaaggagtgtcaagagatcattgggacctcatacctatcggccaagcagatagctgat
gacgtggacttccatggttatctcttttctgagtttgggaaaggtcttatcaagaagtgc
aagaccagccctgatgccttcatccaactggccctgcagttggcacagttcagggaccag
ggagtgttttgtctgacgtacgagtcatcaatgactcgtatgttcagagacggtcggacg
gagacggtacgctcctgcacctctgaggctgttgcatttgtcagagccatggaagacgca
agtggaacaaatgtccagagacttgccctgtttcggagggcagcagataaacatcaaaac
atgtatcgtctggccatgactggttctggtattgaccgtcacctcttctgtctctacata
gtgtccaaataccttggcgttgactcaccatttcttgagaaggtgctttcagagccctgg
aagttgtctaccagccagactccacagcagcagctcaatttagttgacatcaacaagttc
cctaaatatgtgggtgctggtggaggatttggcccagtggctgatgatggctatggtgtg
tcttatatcattgttggggaaaacctcatcacattccacatctcaagcaagttctctagc
cctgacacagactcatgccggtttggtcagcacattcggaaggccatgcttgatatccaa
ggacttttcaagcctgaaaatgataagaagatggtggagcatggaaagcttgtgcagctg
gaaaatgggaaaaagcacatataa

DBGET integrated database retrieval system