KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111658797
Entry
111658797         CDS       T06058                                 

Gene name
cacna1c
Definition
(RefSeq) voltage-dependent L-type calcium channel subunit alpha-1C
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal04010  MAPK signaling pathway
slal04020  Calcium signaling pathway
slal04260  Cardiac muscle contraction
slal04261  Adrenergic signaling in cardiomyocytes
slal04270  Vascular smooth muscle contraction
slal04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:slal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111658797 (cacna1c)
   04020 Calcium signaling pathway
    111658797 (cacna1c)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    111658797 (cacna1c)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    111658797 (cacna1c)
   04261 Adrenergic signaling in cardiomyocytes
    111658797 (cacna1c)
   04270 Vascular smooth muscle contraction
    111658797 (cacna1c)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:slal04040]
    111658797 (cacna1c)
Ion channels [BR:slal04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   111658797 (cacna1c)
SSDB
Motif
Pfam: Ion_trans CAC1F_C GPHH Ca_chan_IQ PKD_channel Rer1
Other DBs
NCBI-GeneID: 111658797
NCBI-ProteinID: XP_023267225
LinkDB
Position
Unknown
AA seq 2233 aa
SDYSPPPPLPRPPPTGLTNEHSGGGSHGDHGGGGGGVNHGVGVVGLAPEHIPTPGAALSW
QAAIDAARQAKMMGNAAAGGGAGLGSGGGGPISTASSTQRKRQHYSSKPKKQTTTTATRP
PRALLCLTLKNPIRRACISIVEWKPFEIIILMTIFANCVALAVYIPFPEDDSNATNSNLE
RVEYLFLIIFTVEAFLKVIAYGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKGDG
ATPIGGKAAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVII
IYAIIGLELFMGKMHKTCVYEHIGTNAEEKPAPCAPDGAYGRHCKQNGTECKMGWEGPND
GITNFDNFAFAMLTVFQCITMEGWTDVLYWMQDAMGYELPWVYFVSLVIFGSFFVLNLVL
GVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPENEDEGMDDDKP
RNLSMPASENESVNTDNAPGGDVEGETCCTRLARYSRRWNRLCRRKCRAAVKSQVFYWLV
IFLVFLNTLTIASEHHQQPQWLTDVQDIANKVLLALFTGEMLLKMYSLGLQAYFVSLFNR
FDSFVVCGGILETILVETKIMSPLGISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVRS
IASLLLLLFLFIIIFSLLGMQLFGGKFNFDETRRSTFDNFPQSLLTVFQILTGEDWNSVM
YDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVDNLADAESLTSAQKEEEEE
KERKKLARLASPEKRHVNEKPPLEEEKKEKIELKSITSDGETNTATKINMDDYCGDETEE
KNPYPANDYIGDDDDDEPEMPVGPRPRPLSDIQLKEKAIPMPEARAFFIFSHTNKFRVLC
HKIVNHNIFTNLILFFILLSSISLAAEDPVKNDSFRNKILGYADHVFTGLFTIEIILKMT
AYGAFLHKGSFCRNYFNILDLVVVSVSLISSGIQSTAINVVKILRVLRVLRPLRAINRAK
GLKHVVQCVFVAIRTIGNIVIVTTLLQFMFACIGVQLFKGKFFYCSDTSKQTEAECRGSY
IMYKDGDVGKPVRASRLWENSDFNFDDVLQGMMALFAVSTFEGWPGLLYRAIDSHAEDVG
PIYNYRVVISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQCVEYA
LKARPLRRYIPKNPYQYKVWYVVNSTYFEYLMFTLILLNTICLAMQHHGQTSNFNDAMNI
LNMLFTGLFTVEMILKLIAFKPRGYFSDPWNVFDFLIVIGSIIDVILSEINGLQNSEENA
RISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQM
FGKIALQDNTQINRNNNFQTFPQAVLLLFRCATGEAWQEIMLACSPNRPCEKGSTNENST
TNEECGSQFAIIYFVSFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWA
EYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVSMNMPLNSDGTVMFNATL
FALVRTALRIKTEGNLEQANEELRAIVKKIWKRTSMKLLDQVVPPAGDDEVTVGKFYATF
LIQEYFRKFKKRKEQGLVAKVPPKTALSLQAGLRTLHDIGPEIRRAISGDLTVEEELDKG
LKEPVSAASEDDIFRVKRTGGLFGNHVNYYNQSDGRGSFPQSFTTQRPLHISQKGSPCEG
ESPSHEKLMDSTTFTPSSYSSSGSNANINNANNTGMAGVATQGISRFPSPSISTVDGHTG
QPLTPILLPRSAWCFPPKRTCFYDNLMRSDSSDSRLPIIRRGEGSTEETYDESYGEDREY
HEDDHSLSSDMLVYHDDTCKQLTPMEEGEEVEDRRGGGWQSPRRVFLCPTSLGRRSSFHL
ECLRRQSRPDVSQKTAVPLHLVHHQALAVAGLSPLLRRSHSPTLFSRLCSTPPASPTAHG
SDASYQRVPSLRLEGSNSHEKLNTSLPSVNCGPWYSDSNGNSRGPSPSPTPSVSVSNQRA
PRPVSLTVPSLLGKDSSTLCHGSAGSLVEAVLISEGLGHFAQDPSFIEATKAELADACDM
TIEEMEHAANNILNGNTTTNATSSTSSTSQHSPNGNLLPFHTAAAATHRDRVVSLSPSEG
GGEAGGSRGSIHGPSSVEERQELLAGGRGREEEEEEAEEREEGHHRSSVVIGAARQRNSG
LLEDEDMECVTSL
NT seq 6704 nt   +upstreamnt  +downstreamnt
gctccgactattctccccctccgcccctgcctcggcctcctcccaccggcctgacaaacg
agcacagtggtggtggtagccatggtgaccatggtggaggagggggcggggtcaaccacg
gggtcggcgtggtgggcctggctccggagcacatccccacaccgggggcggccctgagct
ggcaggcggccatcgacgctgcgcggcaggcaaagatgatgggcaacgccgcagcaggtg
gaggggcagggcttgggtcgggagggggcgggcccatctccacggccagctccacacaaa
ggaaaagacaacactatagctctaagcccaagaaacagacaacgacgacagccacaaggc
cgccacgggccctactctgtctcacgctcaagaaccccatccgcagggcctgcatcagca
tcgtagagtggaaaccatttgagatcatcatcctgatgaccattttcgccaactgtgtgg
ccttagccgtctacatccccttccccgaggatgactcgaacgccaccaactccaacctgg
agcgtgtggagtatctgttcctcatcattttcacggtggaggcgttcctgaaagtaatag
cctatggcctgctcttccaccccaacgcctacctgaggaacggctggaacctgctcgact
tcatcatcgtagtcgtagggttattcagcgcgatcttggagcaggccaccaagggggatg
gggccactcctattggagggaaggcagcaggcttcgatgtcaaggctctgagggcattca
gagtactcagacccctcagactggtctctggagtaccaagtttacaggtagtgttgaact
ccataatcaaagccatggttcctctgctccacatcgccctgctggtcctcttcgtcatca
tcatctatgccatcatcggcctggagctcttcatgggcaagatgcacaagacctgcgttt
acgagcatataggcaccaatgcagaggaaaagccggcaccgtgcgcacctgacggagctt
atggtcgacactgtaaacagaatggaacagagtgtaaaatgggatgggagggtcccaatg
acggcatcaccaactttgacaacttcgcatttgccatgttaacggttttccagtgtataa
ccatggagggctggacggacgtgctatactggatgcaggatgctatgggctatgagctgc
catgggtctattttgtctctctcgtcatcttcggctcctttttcgttctcaatctcgttc
tgggggtgttgagcggagagttttccaaggagagggagaaggccaaggcacgtggtgact
tccagaaactcagagaaaaacagcaactagaggaggacctcaagggctatttagactgga
tcactcaggctgaggacattgacccagagaatgaagatgagggcatggacgatgacaaac
ccagaaacctgagcatgccagccagtgagaatgaatcagtcaacacagacaatgcccccg
ggggagatgtggagggggagacctgctgtacccggctagctcgctactcgcgaaggtgga
acagactctgcagaaggaagtgccgggcggcggtcaaatcacaggttttctattggttgg
tcatcttcctggttttcctcaacactctgaccatcgcctctgaacatcaccagcagcctc
agtggttaactgatgtacaagacatagctaataaggtgttgctagcactcttcactggtg
agatgctgttgaagatgtacagtttgggcctacaggcgtactttgtttcgctctttaacc
gcttcgacagcttcgtagtatgtggaggaattctggagaccattctggtggaaaccaaga
tcatgtctcctctcggcatctctgtgttacgctgtgtacgcttgctacgaatcttcaaaa
taaccagatactggaactcactgtccaacctggtggcctccctgctaaactccgttcgct
ccatcgcttccctgttgctcctgctcttcctcttcatcatcatcttctccctgctcggca
tgcagctctttggtggaaaattcaacttcgacgagacccgacgcagcaccttcgacaact
ttccccaatctctgctgactgtgtttcagatcctaacaggagaggactggaactctgtga
tgtatgatggcatcatggcgtacggtggaccctcttttcctggcatgctggtctgcatct
acttcatcatcctcttcatctgcggaaactatatcctactgaatgtcttcttggccatcg
ctgtagacaatctggccgatgctgagagcctgacatctgcccagaaagaagaggaagagg
agaaagagaggaaaaaactggccaggcttgccagtccagagaagcgtcatgtcaacgaga
agccgcctctggaggaggagaagaaggagaaaatagagctgaagtccatcacttctgatg
gagagaccaacactgctactaagatcaacatggatgactactgtggagatgagactgaag
agaagaatccatatcctgcaaatgattacataggagacgatgatgatgatgagccagaga
tgccagtgggcccgaggccgcggccactctccgacattcagctgaaggagaaagccattc
ccatgcctgaggcccgtgctttcttcatcttcagccacaccaacaaattcagggttcttt
gccataagatcgtcaaccacaacatcttcaccaacctcatccttttcttcatcctgctca
gcagcatcagtcttgcagcagaggacccagtcaagaatgactccttcagaaacaagattc
tgggctatgcagatcatgtcttcactggactgttcaccatagagatcattcttaagatga
cagcctatggagccttcctccacaaaggttcattctgtagaaactatttcaacatcctgg
acctggtggtggtcagtgtgtccctcatctcctctggaatacagtccactgcaattaatg
tggtgaagatcctgagagttctgagagtgctcaggccactaagagccatcaacagagcta
agggactaaagcatgtagtgcagtgcgtgtttgtggcaatcaggaccatcggcaacatcg
tcattgtcaccacgttgctccagttcatgttcgcctgtattggagtacaactctttaagg
gcaagttcttctactgttccgacacctctaaacagactgaggcagagtgcaggggttcct
acatcatgtataaagacggtgacgtggggaagcctgtcagagcctcgagactgtgggaga
acagtgactttaactttgatgatgtcctgcaaggcatgatggctctgttcgctgtgtcta
cctttgaggggtggccagggttactgtaccgggccatagactctcatgctgaggatgtcg
ggcccatctacaactaccgtgtggttatctccatcttcttcatcatctacatcatcatca
ttgccttcttcatgatgaacatcttcgtcggtttcgtcattgtcacattccaggagcaag
gagagcaagaatataagaactgtgagctggacaagaaccagcgtcagtgtgtggagtatg
ccttgaaggcccgtccattgcgccgctacatccctaagaacccctaccagtacaaggtgt
ggtatgtggtcaactccacctactttgagtacctgatgttcacactcatccttctcaaca
ccatctgtctggccatgcagcatcatggacagacctcaaatttcaatgatgccatgaaca
tcctcaacatgctcttcactggacttttcactgtggagatgatccttaaactgattgcct
tcaaaccaagggggtactttagtgatccctggaatgtgtttgatttcctcatcgtaattg
gcagcataatagacgtcattctcagtgagatcaacggactgcagaactctgaagagaacg
ccaggatctccatcaccttcttccggctgttccgcgtgatgaggctggtgaagctgctgt
ctcgcggggaagggattcggaccctgctgtggaccttcatcaaatccttccaagctctgc
cctacgtagctctgcttatagtgatgctattcttcatatacgctgtcatcggcatgcaga
tgtttggtaagatagcgctgcaggataacacgcagatcaacaggaacaacaatttccaga
cgttccctcaggcagtgctgctgctcttcagatgtgcaacaggcgaggcgtggcaggaga
tcatgctggcgtgctcgcccaatcggccatgtgagaagggctcaaccaacgagaacagca
cgaccaatgaagaatgtggcagccagtttgccatcatttactttgtcagcttctacatgc
tctgtgccttcctgatcatcaacctgtttgtggctgtcatcatggacaactttgactacc
tgacgcgtgactggtcgatcctggggccgcatcatctggacgaattcaagaggatctggg
ctgaatatgacccagaagctaaggggaggataaagcaccttgatgtggtgactctgctcc
ggagaatccaacctcccctcggctttggaaagctttgtccccacagggtggcctgcaagc
gtctggtgtcaatgaacatgcctctgaacagcgatggaacagtgatgttcaacgccacac
tgtttgccctggtcagaaccgcactcaggattaagacagaaggtaacctggaacaggcca
atgaggagctgagagcaatagtgaagaagatctggaagagaaccagcatgaagctcttgg
atcaagtagtgccccctgctggtgatgatgaagtaacagtcgggaagttctacgctacct
tcctcatccaggaatatttccgcaagtttaagaagaggaaagaacaagggctggtagcca
aggtgccccccaaaactgccctctctctgcaggcgggcctgcggacgttgcatgatattg
gaccagagattcggagggccatctctggagacctgacagtggaggaggagctggataaag
gcctgaaggagcccgtgtcggctgcatccgaggacgatatcttcagggtaaagcgtacgg
gtgggttattcggcaaccatgtcaactactacaaccagagtgatggccgcgggtccttcc
ctcagtccttcactacccagcgccctttgcatatcagccagaagggctcaccttgcgaag
gcgaaagcccgtcccacgagaagctcatggactcgaccactttcaccccttcctcttact
cctcatcaggctccaacgccaacataaacaatgccaacaacaccggcatggccggggtgg
caacccagggcatcagccgattcccaagcccgtctataagcactgtggatgggcacacag
gacagccactcacccccatcctgctgccaagatctgcgtggtgctttcctccaaagagga
cgtgtttttatgacaacctcatgcgctcggactcaagtgacagccgtctgccaatcatac
gaagaggggaggggtcaacggaggagacttacgatgagagctatggcgaggacagggagt
accatgaggatgaccactcgctctcctctgacatgctggtgtatcatgatgacacgtgta
agcagttgactcccatggaggaaggagaggaggtagaggacagaagaggaggaggatggc
agtctcccaggagagtcttcctctgccccacttctctggggcggagatcgtccttccatc
tggagtgtcttaggagacagtcaaggccagacgtgtcccagaagacggctgtacccttgc
accttgtacatcatcaggcgctggcagtggcagggttgagtcctctgctaagaaggagtc
actcacctaccctcttcagtcggctgtgctctacacctccagccagtcccacagctcatg
gcagtgatgcctcctaccagcgagtgccctctctgaggttagagggctccaactcccatg
aaaagctcaataccagcctgccctctgtcaactgtgggccctggtacagtgacagtaatg
ggaacagccgggggcctagtcctagtcccacccccagcgtgtcagtgtccaatcaaagag
caccacggccagtgtcgctcacagtaccctcgctactgggaaaagactccagcacgctgt
gtcacggcagtgcaggcagtctggtggaggcggtgctaatatcagagggtttgggtcatt
tcgctcaggacccatcattcatcgaggcgaccaaagccgagttagctgacgcctgtgaca
tgaccatcgaggagatggaacacgccgccaacaacattctcaacggcaacaccaccacaa
acgctacatccagcacctcctccacctcccagcacagccccaacggcaacctcctcccct
tccacacagcagcagcagcaacgcacagggaccgagtggtcagcttgagtcccagcgagg
gcgggggagaggccggaggaagcagaggctccatccacgggccatcctctgtggaggagc
ggcaggagctgctagcagggggcagaggacgagaagaggaggaggaagaggcggaagaaa
gggaggaggggcaccacagaagctcagttgtgattggagcagcgcggcagaggaacagcg
ggctgttggaggacgaggatatggagtgtgtgacgagtttgtag

DBGET integrated database retrieval system