KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111659926
Entry
111659926         CDS       T06058                                 

Gene name
ikbkg
Definition
(RefSeq) NF-kappa-B essential modulator isoform X1
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal04010  MAPK signaling pathway
slal04210  Apoptosis
slal04620  Toll-like receptor signaling pathway
slal04621  NOD-like receptor signaling pathway
slal04622  RIG-I-like receptor signaling pathway
slal04623  Cytosolic DNA-sensing pathway
slal04625  C-type lectin receptor signaling pathway
slal04920  Adipocytokine signaling pathway
slal05132  Salmonella infection
slal05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:slal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111659926 (ikbkg)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    111659926 (ikbkg)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111659926 (ikbkg)
   04621 NOD-like receptor signaling pathway
    111659926 (ikbkg)
   04622 RIG-I-like receptor signaling pathway
    111659926 (ikbkg)
   04623 Cytosolic DNA-sensing pathway
    111659926 (ikbkg)
   04625 C-type lectin receptor signaling pathway
    111659926 (ikbkg)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    111659926 (ikbkg)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111659926 (ikbkg)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    111659926 (ikbkg)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:slal01001]
    111659926 (ikbkg)
Protein kinases [BR:slal01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   111659926 (ikbkg)
SSDB
Motif
Pfam: CC2-LZ NEMO zf_C2H2_10 HBS1_N
Other DBs
NCBI-GeneID: 111659926
NCBI-ProteinID: XP_023268782
LinkDB
Position
Unknown
AA seq 638 aa
MTAWVPVIPDNTTEKGVGMVQPQPDGPMQWDMSGEESGGALRVPPELAANEVVTRLLGDN
QQLREALRRSNLALRQRCEEMEGWQRRTREEREFLSSRFQEARALVERLAQENHSLQSLV
SGPTSSSNHCCSSSQTEDLQGRPARNGPLEGPQTLDQRDKKRVEETDQHTQTTPPRSLGG
ASVHSSLSSPLPTPPTSFSEVLGEVMGRESGQPVEGANEFLQLLKSHKEKLEEGMRELRR
KNEELERDREEGEKERERMRRCIDQLRAKLAQAQVSNVTEENVPHRSEAQHSSDCSSLAK
LTEQLQATQGRYRELEEKLDYLQKSSAQRDRTEALLKQKDKDCAQLAKDCEALKAQATSL
LGELNERQSCLEKSEHERKMLEEKLCSKLKALQVAERELEQQRKQHHVAMDKLLLQTQSL
EQALKTERHVVTEEKKKLTQLQHAYTCLFRDYDSKLKSEGGDLCSRLEEAERALALKQDL
IDKLKEEVEQQKGSLETVPVLAAQAEIYKADFLAEREAREKLNQKKEELQDQLNQAQAEI
ERLKQDAASRARMEQMKMRHMEDFPPRAPLIPPPQGVFPGPAFNTVPPAPSFRNQGLVPV
GDQGAAGAEELPDLCCPKCQYQAPDMDTLQIHVMDCIQ
NT seq 1917 nt   +upstreamnt  +downstreamnt
atgacagcctgggtgcctgttattccggacaacacaactgaaaaaggagtggggatggtg
cagccccaacctgatggcccaatgcagtgggacatgtcaggagaggagagtggaggggcc
ctcagggtcccaccagagcttgctgccaatgaagtggtgaccaggttgctgggtgataac
cagcagcttagagaggccttgcggcggagcaacctggccttgcgtcagcgctgtgaggag
atggagggatggcagcgaaggacaagagaggaaagagaatttctcagctctcgtttccag
gaggccagggccctggtggagaggctggcccaggagaaccactccttacagagcctggtc
agtggtccgacctcctcttctaaccactgctgcagctccagccaaaccgaagacctgcaa
ggacgcccagccaggaacggtccactcgaaggaccacagactctagatcagcgggacaag
aagagagttgaagagacggatcaacacacacagaccacgccacctcgcagcctgggcggt
gcgagtgtgcatagctccttgagtagccccctccccactccccccacctcattttcagag
gtactgggggaggtgatgggcagggaaagtggccagcctgtggaaggtgcaaacgagttc
ctgcagctgctgaagagccataaagaaaaactggaggaagggatgagagagctgaggagg
aagaacgaagagctggagagagacagagaagagggagagaaagagagagaacggatgcgg
cgctgcattgaccaactacgagccaaactggcgcaggcacaggtgagcaacgttactgag
gagaatgttccacatcgctctgaggcgcagcactcctctgactgctctagcctggctaaa
ctcacagagcagcttcaggccacacagggcaggtatcgggagctggaggagaagcttgat
tacctgcagaagagttcggctcagcgagacagaactgaagctctgctcaaacagaaggac
aaagactgtgctcagctggccaaagactgtgaggctctgaaagctcaggcaacttccctg
ttaggagaactgaatgagagacagagctgcctggagaaaagcgagcatgaacgcaaaatg
ttggaagaaaaactgtgcagtaagctgaaggccctgcaggtggcagagcgggagctggag
cagcagaggaagcagcatcatgtggccatggacaagctgctgctgcagacccagagcctg
gagcaggccctgaagacagagagacatgtcgtcacagaggagaaaaaaaaactgacacag
ctgcaacacgcctacacatgtctctttagagactacgactctaaactgaagagtgaggga
ggagatctgtgcagccgactagaggaggcagagcgagcgctggctctgaagcaggatctg
atcgataaactgaaggaggaggtggagcaacagaaaggctccctggagactgttcctgtc
ctcgctgcacaggctgagatctacaaggcagatttcctggcagagcgagaagcaagagag
aagttgaaccagaagaaggaggagctgcaagatcaactgaatcaggcccaggctgagatt
gaaaggctcaaacaggatgctgcatcacgcgcacgtatggagcaaatgaagatgaggcac
atggaggactttccaccacgggccccgctcattcctcctccacaaggtgtgttccccggg
ccagcttttaacacagtgccccctgccccctcattccgcaatcagggtttggtaccagtc
ggtgatcaaggagcagctggagctgaggagctgccagatttatgttgtccaaagtgccag
taccaggctccagatatggacacactgcagatacatgtcatggactgtatacagtaa

DBGET integrated database retrieval system