KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111660053
Entry
111660053         CDS       T06058                                 

Gene name
cd36
Definition
(RefSeq) platelet glycoprotein 4
  KO
K06259  CD36 antigen
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal03320  PPAR signaling pathway
slal04145  Phagosome
slal04512  ECM-receptor interaction
slal04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:slal00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    111660053 (cd36)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    111660053 (cd36)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    111660053 (cd36)
   03320 PPAR signaling pathway
    111660053 (cd36)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:slal04131]
    111660053 (cd36)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:slal04147]
    111660053 (cd36)
   04090 CD molecules [BR:slal04090]
    111660053 (cd36)
Membrane trafficking [BR:slal04131]
 Endocytosis
  Phagocytosis
   Scavenger receptors
    111660053 (cd36)
Exosome [BR:slal04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   111660053 (cd36)
CD molecules [BR:slal04090]
 Proteins
  111660053 (cd36)
SSDB
Motif
Pfam: CD36 PorA
Other DBs
NCBI-GeneID: 111660053
NCBI-ProteinID: XP_023268938
LinkDB
Position
Unknown
AA seq 469 aa
MGCCNRRSGLIAGAVFGAVVAILGGVLIPLGNSVIEGTVKKEAVIEPGTTAYDNWVATGA
NVYRQFWFFHVQNPQEVLQQGAIPVVVEKGPYTYRTRYLPKENVTFNLNQTASFLLPLGA
IFEPSMSVGPEEDNVTSLNLAVAAAYSLVPKQLHLVLENLIKASKSSLFQQRTVKEMLWG
YTDPMLKGTVGLFVPYNGTYDGYYTVFTGKEDISKVGLIDRWQGETSLRFWNDKYCDMIN
GTDASSFPPFVDKKKPLYFFSSDICRSVSASFEKSMDLKGIEVYRYALQPSTLASPMVNP
DNRCFCRNPITTKNCTMAGVLDISSCKEGKPIYISLPHFLHGSPSLRESVLGLNPSEEHH
HTFLDVEPTTGFTLRFAKRIQVNMMYGPSDVITVLKKVKDYTIFPLVWMNETAALDDATA
DMFKEELVSRIQMLEMIQQVLLGTGVAIFILCLISYCVVRRRDNDVKIV
NT seq 1410 nt   +upstreamnt  +downstreamnt
atgggctgctgcaacagaaggtccgggctgatagctggagctgtgtttggggcggtggta
gccatcctgggaggtgtcctgatcccactggggaacagcgtcattgaggggacagtgaag
aaggaagccgtcattgagcctggaacgacagcgtatgacaactgggtggctacaggggca
aatgtgtaccggcagttttggttctttcacgtgcaaaatcctcaggaggttttgcagcag
ggcgcaattccagtggtggtggaaaaaggaccttacacatacaggacaagatatcttccc
aaagagaacgtcaccttcaacctaaatcaaactgcctccttcctgctgcctctgggtgcc
atcttcgagccatccatgtcagtgggaccagaggaagacaatgtcacctccctcaacctg
gctgtggctgcggcttactcactggttccaaaacaacttcatcttgtgcttgagaatctg
ataaaggcaagcaagtcctccttgtttcagcagcgtacagtgaaggaaatgctgtggggt
tacacagaccccatgttgaaaggaactgtgggcttatttgtaccttacaatggcacctat
gatggctactacactgtcttcactggaaaggaggacatctcaaaagtgggacttattgac
aggtggcagggagagacgagcttacgtttctggaatgacaagtactgtgacatgatcaac
gggacagatgcctcctccttccctccctttgtggataagaaaaagcctctatatttcttc
tcatcagacatctgcaggtctgtctcggccagctttgagaaaagcatggatctgaaaggg
attgaggtctaccgctacgccctccagccatctaccctggcctcccctatggtcaaccca
gacaacagatgtttctgcagaaacccaatcaccaccaagaactgcaccatggccggagta
ctggacatcagctcctgtaaagagggaaaacctatctacatctctctgccccacttcctt
cacggcagtccatctctgcgagagtctgtactgggtctcaaccccagtgaggagcatcat
cacaccttcctagacgtggagcctacaactgggttcaccctgaggtttgctaagagaatt
caagtgaatatgatgtatggaccatcagatgtcatcacggttcttaagaaagtcaaggat
tataccatattccctcttgtttggatgaatgagactgctgcgttggatgacgcaacagca
gacatgtttaaggaggagctagtctcccgtatccagatgttggaaatgatacagcaggtg
ctgctgggcacaggtgtggccattttcatcctgtgccttatctcttactgtgtggtgagg
cggagagataatgacgtcaagattgtgtga

DBGET integrated database retrieval system