KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111660366
Entry
111660366         CDS       T06058                                 

Gene name
acacb
Definition
(RefSeq) acetyl-CoA carboxylase 2 isoform X1
  KO
K01946  acetyl-CoA carboxylase / biotin carboxylase 2 [EC:6.4.1.2 6.3.4.14 2.1.3.15]
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal00061  Fatty acid biosynthesis
slal00620  Pyruvate metabolism
slal00640  Propanoate metabolism
slal01100  Metabolic pathways
slal04910  Insulin signaling pathway
slal04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:slal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    111660366 (acacb)
   00640 Propanoate metabolism
    111660366 (acacb)
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    111660366 (acacb)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    111660366 (acacb)
   04920 Adipocytokine signaling pathway
    111660366 (acacb)
Enzymes [BR:slal01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.15  acetyl-CoA carboxytransferase
     111660366 (acacb)
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     111660366 (acacb)
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     111660366 (acacb)
SSDB
Motif
Pfam: ACC_central Carboxyl_trans CPSase_L_D2 Biotin_carb_N Biotin_carb_C Biotin_lipoyl ATP-grasp Dala_Dala_lig_C ATP-grasp_3 ATP-grasp_4
Other DBs
NCBI-GeneID: 111660366
NCBI-ProteinID: XP_023269388
LinkDB
Position
Unknown
AA seq 2434 aa
MFPFAVLGLILWIFLLLWRINTKTGVMHVKGEGSLSGCGPPAAEEDMSATHTPHPDKHFL
STVPTTSTHNENNSPLANSASAGLDIKTVDSEAPQSSSEVNSELSSLPPATQKTYKSNVP
KFSSGPQARERLKFILGASEDNSSDEEPLVTKPPSGTSQPLSSTLKTSPQQASSAVPQSS
SSGIKPSMSGPHLVKKGREHRKMDLQRDFTVASPAEFVTRFGGNRVIEKVLIANNGIAAV
KCMRSIRRWSYEMFRNERTIRFVVMVTPEDLKANAEYIKMADHYVPVPGGPNNNNYANVE
LIVDIAKRIPVQAVWAGWGHASENPKLPELLNKAGISFLGPSSKAMWALGDKVASSIVAQ
SADIPTLPWSGSGLRVNWAEEDQGLGNVISVPPEVYGKGCVHDVDDGLAGAEIIGYPVVI
KASEGGGGKGIRKVESSEDFPSSFRQVQTEVPGSPIFIMQLAQHARHLEVQILADEYGNA
ISLFGRDCSIQRRHQKIIEEAPATIAAPSTFEQMERYAVRLAKMVGYVSAGTVEYLFSED
GNFHFLELNPRLQVEHPCTEMIGDVNLPAAQLQIAMGIPLHRIKDIRLFYGETPWGDTIV
NFETPYCIPSPRGHVIAARITSENPDEGFKPSSGTVQELNFRSSKNVWGYFSVGATGGLH
EFADSQFGHCFSWGENREEAISNMVVAMKELSIRGDFRTTVEYLIKLLETESFRNNDIDT
GWLDHLIAEKVQAERPDTMLGIVCGALHVTDASFRKSMSDYLHSLERGQVLPAASLLNSV
NVDLIYEGVKFCLKVARQSPTTYVIMMNGSNIEIDVHRLSDGGLLLSYDGSSHTTYMKEE
VDSYRITVGNKTCVFEKEKDPTVLRSPSAGKLLQYVVEDGGHIVAGETYAEIEVMKMVMT
LTVQQSGCIHFVKRPGAVLEHGCVVAHMDLDDPSSIHRVELNTATLPPQQPLPMVGEKLH
QVFHSVLENLVKVMDGYCLEEPYFSSKLKQWVATLMKTLRDPSLPLLELQEIMTSVAGRI
PPSVEKDIRKVMAQYASNITSVLCQFPSQRIANILDSHAATLQRKSDREVFFMNTQSIVQ
LVQRYRSGIRGYMKSVVLDLLKRYLQVEMQFQQAHYDKCVINLREQHKPDMSPVLEYIFS
HAQVSKKNVLVTMLIDQLCGRDPTLADELMVILNELTQLSKMENSKVALRARQVLIASHL
PSYELRHNQVESIFLSAIDMYGHQFCPENLKKLILSETSIFDVLPNFFYHANQVVCMAAL
EVYVRRGYIAYELNSIQHHQLQDRTCAVDFQFMLPSSHPNRGSSPTLNRVPVPVNGSGQF
KMRRQGSELFLEGALSPPCQRMGAMVAFQCFDDFKRNFDEVLSSFAEPLLESAPFSESCS
NLYEEENCKNTKENPIHIINVSIKTADTEDDDALVTAFTAFAQSKRAILFEYGIRRITFL
IAQKREFPKFFTFRARDGFQEDRIYRNLEPALAFQLELNRMRNFDLTAVPCANHKMHLYL
GAARVQEGTEVTDYRFFIRAIIRHSDLITKEASFEYLQNEGERLLLEAMDELEVAFSNTS
VRTDCNHIFLNFVPTVIMDPSKIEESVRSMVMRYGSRLWKLRVLQAELKINIRLTPTGNA
VPIRLFLTNESGYYLDISLYKEVNDPSSGQIMFQSYGDKQGPLHGMLINTPYVTKDLLQA
KRFQAQTLGTTYVYDFPEMFRQALLKRWGPGDKCPQDVLMCTELVLDPQGRLVQMNRLPG
DNDVGMVAFRMKMKTPECPESRDIIVICNDITHMIGSFGPQEDELFLRASELARAEGIPR
IYIAANSGARIGLAEEIKHMFQVAWIDPNDPYKGFKYLYLTPQDYTRISSTNAVHCHHVE
EGGESRYIITDIIGKDEGLGVENLRGSGMIAGESSQAYEEIITISMVTCRAIGIGAYLVR
LGQRVIQVENSHIILTGAGALNKVLGREVYTSNNQLGGVQIMHNNGVTHTTVPDDFEGVF
TILQWLSYMPKNKHSPVPVIATTDPVDREIEFAPTKAPYDPRWILAGRPHPTVRGAWQSG
FFDHGSFMEIMESWAQTVVVGRARLGGIPLGVIAVETRTVEFTVPADPANLDSESKVLQQ
AGQVWFPDSAFKTAQAICDFNRERLPLMVFANWRGFSGGMKDMYDQILKFGAYIVDALHG
FHQPVLVYIPPHAELRGGSWVVIDPTINPLCMELYADRESRGGVLEAEGTVEIKFRRKDL
LKTMRRLDSVYASLVEQLASLELSDKQCKELESKLKAREEFLLPIYHQVAVQFADLHDTP
GRMQEKGVITDILDWKNVRTFFYWRLRRLLLEQVVKYEILQANKDLGDGHMQSMLRRWFV
ETEGTVKAYLWDNNQAVVEWLEKHLSTEDGTRSAIRENIKYLKRENTLKHIRSLVQANPD
VAMDCIIHMSQNITPSQRAKLLHLLATVDSTSTS
NT seq 7305 nt   +upstreamnt  +downstreamnt
atgttcccgttcgcagttttgggattaatcctatggatatttttgctgctgtggaggatt
aataccaagacaggagtgatgcatgtgaaaggagagggatctctgtctggctgtggtccc
ccagcagccgaggaagacatgtctgctacacacactcctcatccagacaaacatttcctg
tcaacagtacccactacctcaacacacaatgagaacaacagtcctctggctaacagtgcc
tctgcaggtcttgacatcaaaacagtggactctgaggctccacagtcttcctctgaagta
aattcagagctgtcatcgttgccaccggccacccagaaaacttacaaatccaatgtgcca
aagttcagctcagggccccaggcgagggaacgcctgaagttcattcttggagcatcagag
gataactcctcagacgaggagcctcttgtcaccaaacctccaagtggtacatctcagcct
ctgagttccaccctgaaaacttcccctcagcaggcgtcctctgcagtcccgcagtccagc
tcctcaggcatcaagcctagcatgtcaggtcctcacttggtgaaaaaaggacgtgaacac
agaaagatggatctacagagggacttcactgtggcctctcctgctgagtttgtcacccga
tttggtggcaaccgtgttattgaaaaagtgctgatagcaaacaatggcattgctgcagtc
aaatgtatgcgttctatccgtcgctggtcctatgaaatgtttcgcaatgagaggaccatc
cgctttgtggtcatggtaaccccagaagacttgaaagccaatgcagaatacattaaaatg
gcagaccattatgtgcctgtacctggtgggcccaacaataacaactatgccaatgtagag
ctcatagtggacattgcaaaaagaatcccagtccaggctgtgtgggccggctggggccat
gcctcagaaaatcccaaactgcctgagctcctgaacaaagcaggaatatcattcttaggg
ccatccagtaaagccatgtgggctctaggggataaggtggcttcctccattgtggcccag
agtgctgacattcccacactaccatggagcggatcaggtctgagagtgaactgggcggag
gaggaccaaggactgggcaatgtgatcagtgttcctccagaggtgtatggaaagggctgt
gttcatgatgtagatgacggactggcaggagctgagataattggttatccagttgttatc
aaggcctctgagggtggtggtggaaagggtatccggaaagtagaaagttctgaggatttt
ccgagttccttcagacaggttcagacagaggtacccgggtcacccatcttcatcatgcag
ctggctcagcatgcgagacaccttgaggttcagatactggctgatgagtatggaaatgcc
atctctctgtttggacgagactgctccatccagagaaggcaccagaagatcatagaggag
gctcctgccaccatagctgctccctcaacattcgagcaaatggaacggtatgcagtgcgt
ctggccaagatggtgggctatgtgagtgcaggtactgtggagtatctcttctctgaagac
ggaaatttccacttcctggagctgaatcctcgcctgcaggttgaacatccctgtacagag
atgatcggagatgtgaacctacctgctgcccagcttcagattgcgatgggaatccccctt
catagaattaaggacatccgcttgttttatggagaaactccatggggtgacaccatcgtt
aactttgagactccgtactgcataccaagtccaagagggcacgtcatagctgctcgcatc
accagtgagaaccctgatgagggattcaagcctagttctggcaccgtgcaggagctgaac
ttccgcagcagtaaaaacgtgtggggttatttcagtgtgggtgcgactggtggtctgcat
gaatttgcagactcacagtttggacactgtttctcctggggcgagaaccgtgaagaagcc
atttcgaacatggtggtggctatgaaagagctgtctatcagaggtgacttcaggacaacg
gttgaatacctcattaagttactagagacagaaagcttcagaaacaatgacattgacact
ggctggctggatcatctgattgcagagaaagtgcaggcagagagaccagacaccatgctg
ggtatcgtctgtggggctttgcatgttactgatgccagcttcaggaagagcatgtctgac
tacctacattccctggaaagaggccaagtcctgcctgcagccagtctcctcaactctgtc
aatgtggaccttatatatgaaggagtcaagttctgcctcaaggtggctcgccagtcccca
acaacttatgtcatcatgatgaacggctccaacattgagatagatgttcacaggctgagc
gacggaggtcttctgttgtcctacgatggcagcagccacaccacctacatgaaagaggaa
gtagacagctaccgcatcactgttggcaacaagacctgtgtatttgagaaggagaaggat
cccacggtgctaaggtcgccctctgctggcaaactgctgcagtacgtggttgaggatggg
ggtcatattgttgcaggagagacttatgctgagattgaggtgatgaagatggtgatgact
ctgactgtgcagcagtctggttgcatccactttgtcaagagacctggagcagtactggag
catggctgtgtggtggcacatatggacctggatgaccccagcagtatacacagggtggag
ctcaacacagccacacttccaccccagcaaccgttgcccatggttggggaaaagcttcac
caggtgttccacagtgtgcttgaaaacctggttaaagtcatggatggctactgcctggaa
gaaccttacttcagcagcaagctgaaacagtgggtggctaccctgatgaagactctaaga
gacccctccctgccgctgttggaactccaggagatcatgaccagcgtggccggtcgtatt
ccaccgagtgttgagaaagacatccgtaaagtcatggctcagtatgcgagcaacatcacc
tctgtcctctgccagttccccagtcagaggattgcaaatattctagacagccatgcagcg
accctacagaggaagtctgaccgagaggttttcttcatgaacactcagagtattgtacag
ctggtacagaggtatcgcagtggaatccgtggttatatgaagtctgtggttctcgatctg
ctgaagcgctacctgcaagtagagatgcagtttcagcaagctcactatgacaagtgtgtg
atcaacctgagagagcagcacaaacctgacatgagtcccgtcctggagtacatcttctct
catgcccaggtctccaagaagaacgtcctggtcactatgctcatagaccaactgtgtgga
agagatcccaccctggcagatgagctgatggttattctgaatgaactcacacagctcagc
aagatggaaaactcaaaggtggccttgagagccagacaggtcttgattgcctcccattta
ccatcatatgaactgagacacaaccaggtggaatccatcttcctgtcagccatcgacatg
tacggccaccagttttgcccagagaacttgaagaaactcattctctccgaaacctccatt
tttgatgttttgcccaatttcttctatcacgccaatcaagttgtatgcatggctgctttg
gaggtgtatgtgcgcagaggttatatcgcctacgagctaaatagcatccagcatcaccag
ctgcaggatagaacgtgcgctgtagacttccagttcatgttgccatcatcacatccaaac
agagggagcagccctactctgaacagggttcctgtgccagtgaatggatcaggccaattt
aaaatgaggcggcagggcagtgagctcttcctggagggagccttgtctccaccctgccaa
cgcatgggtgccatggtggctttccagtgttttgatgacttcaaaaggaattttgatgaa
gttctctccagcttcgctgaaccactgttggagagtgctccgttctcagagtcctgctcc
aatctctatgaggaggagaactgcaagaatacaaaggagaacccaatccacatcattaat
gtgtccataaaaacagcagacacagaggatgatgacgccttggtcacagccttcactgcc
ttcgcccagtcaaagagagcaatcctgtttgagtatggaatcaggagaatcacatttttg
attgcacagaagagagaatttcccaagttcttcactttcagagcgagggacgggttccag
gaagatcgcatttaccgcaatctggagccagctttagcgtttcagctggagctcaaccgc
atgaggaactttgaccttacagctgttccctgtgccaaccacaagatgcacttataccta
ggtgctgcccgtgttcaggagggtactgaagtcactgactaccgcttcttcattcgagct
attatccgccactcagatctcattacaaaggaggcctcctttgaataccttcagaacgag
ggagaacgtcttctactggaggccatggatgagctggaggtggccttcagtaacaccagt
gtccgcacagactgcaaccacatcttcctcaactttgtcccaactgtcatcatggaccct
tccaaaatagaagagtctgtccgctccatggtgatgcgctatggcagccgtctttggaag
ctgcgtgtcctgcaggccgagctgaagatcaacatccgcctgacgccaacaggaaatgcc
gttcctatccgcctgtttctcactaatgagtccggctattatttggacatcagcctgtac
aaggaagtcaacgacccaagttctggacagatcatgttccagtcatatggggacaagcag
ggtcctctgcatggcatgctgatcaacactccctatgtgaccaaagacctgctgcaggcc
aaacgcttccaggctcaaactctgggcactacatatgtctatgacttccctgagatgttc
agacaagcactattaaagcgttggggtccaggggacaaatgccctcaagacgtgctgatg
tgcactgagctggttctggacccacaaggtcgactggtgcagatgaaccgcctgcctgga
gataatgacgtgggaatggtcgcctttaggatgaagatgaagactccagagtgcccagag
agcagagacatcattgtcatctgtaatgacatcactcacatgatcggctcgtttggtcct
caggaggatgagctgttcctcagggcatctgagctggctcgggctgagggcatccctcgc
atttacatcgcagccaacagtggcgcacgcatcggcctcgctgaagaaatcaaacacatg
ttccaggtggcgtggattgaccccaatgacccctacaagggcttcaagtacctctacctg
acacctcaggactacacacgcatcagctccaccaacgctgttcactgtcaccatgtagag
gaaggtggagagtccaggtacatcatcactgacatcatcgggaaagatgaaggtctcggt
gttgagaacctgcgaggttctggcatgatcgctggagaatcttctcaggcgtatgaggag
attattacaatcagtatggtgacgtgtcgcgctattggaattggagcctatctggtccgt
ttgggacagcgagtgatccaggtggaaaactctcacattatcctgactggagcaggcgct
ctgaacaaggttctgggcagagaggtctacacttctaacaaccagctgggaggagtccag
atcatgcacaataatggagtcactcacaccactgtgccagatgactttgagggcgtcttc
accatcctgcagtggctctcctacatgccaaagaacaaacactcccctgtgcctgttata
gcaactacagatccagtagacagagaaatagaattcgctcctacaaaagcaccgtacgac
cctcgctggattttggctgggagacctcaccccacggtgagaggtgcctggcagagtgga
ttcttcgaccacggttctttcatggagatcatggagtcttgggctcagacagtggtagtg
ggaagagcacggctagggggaatccccctcggtgtcattgctgttgaaacacgcacagtt
gagttcactgtccctgccgatccagccaacctggattcagaatctaaagttctgcagcag
gcgggccaggtgtggttcccagattcagcctttaaaacagctcaggccatttgcgacttc
aaccgtgaacggctgcctctcatggtgtttgccaactggaggggcttctctgggggaatg
aaggatatgtatgaccaaatattgaagtttggggcctatattgttgatgccctgcatggt
ttccaccagccagtgctggtgtacatcccaccgcatgctgagttgaggggagggtcctgg
gtggtgattgaccctaccatcaaccccctgtgtatggagctctatgctgacagggagagc
agagggggtgtgctggaggctgaaggtacagtggagatcaaattcaggaggaaggacctg
ctgaagaccatgagaagactagattcagtctatgccagtctggttgagcagcttgcttcc
ctggagctgtctgacaaacagtgcaaagagctggagtcgaagctcaaagcaagagaggaa
ttcctattgcccatctaccaccaggtggcagtgcagtttgcagacctccatgacacccca
gggaggatgcaggagaagggtgtcatcactgatattttggattggaagaatgtgcggacc
ttcttctactggcgtctgcgtcgcctcctgttggagcaggtggtgaaatatgagattctg
caggccaacaaggaccttggtgacggacacatgcagtccatgctgcgacgctggtttgtt
gaaacagagggaacagtcaaggcttacctttgggataataaccaagcagtagttgagtgg
cttgagaagcatttgtccacagaggacggcactcgatcagctatccgagagaacatcaag
tacttgaaacgtgaaaacactttgaaacacatccgcagcctggtgcaggccaaccctgac
gtagccatggactgcatcatccacatgagccagaacatcactccgtcccagagggccaag
cttttgcatctgctcgcaactgtggacagcaccagcaccagttaa

DBGET integrated database retrieval system