KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111660433
Entry
111660433         CDS       T06058                                 

Gene name
stat3
Definition
(RefSeq) signal transducer and activator of transcription 3 isoform X1
  KO
K04692  signal transducer and activator of transcription 3
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal04068  FoxO signaling pathway
slal04217  Necroptosis
slal04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:slal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    111660433 (stat3)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    111660433 (stat3)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    111660433 (stat3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:slal03000]
    111660433 (stat3)
Transcription factors [BR:slal03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    111660433 (stat3)
SSDB
Motif
Pfam: STAT_alpha STAT_bind STAT_int SH2 AAA_18 AP1AR Syntaxin-6_N
Other DBs
NCBI-GeneID: 111660433
NCBI-ProteinID: XP_023269483
LinkDB
Position
Unknown
AA seq 783 aa
MAQWNQLQQLETRYLEQLYHLYSDSFPMELRQFLAPWIESQDWAYAANKESHATLVFHNL
LGEIDQQYSRFLQENNVLYQHNLRRIKQHLQSKYLEKPMDIARIVARCLWEEQRLLQTAT
SAAQDGQAAHPTGTVVTEKQQILEHNLQDIRKRVQDMEQKMKMLENLQDDFDFNYKTLKS
QGELSQDLNGNSQAAATRQKMAQLEQMLSALDQLRRQIVTEMGGLLTAMDYVQKNLTDEE
LADWKRRQQIACIGGPPNICLDRLETWITSLAESQLQIRQQIKKLEELQQKVSYKGDPII
QHRPALEEKIVDLFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTNKVRLLVKFPELN
YQLKIKVCIDKESGDVAAIRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCG
NGGRTNSDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILW
YNMLTNHPKNVNFFTKPPVGTWDQVAEVLSWQFSSTTKRGLTIEQLTTLAEKLLGPCVNY
SGCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILS
PKPPGTFLLRFSESSKEGGITFTWVEKDISGKTQIQSVEPYTKQQLNSMSFADIIMGYKI
MDATNILVSPLVYLYPDIPKEEAFGKYCRPEAAPETELGDSTSITQPYLKTKFICVTPCP
SVFMDLPDSELLGNGFPGTNSGNTSDLFPMSPRTLDSLMHNEAEANPGHLDSLTLDMDVA
SPM
NT seq 2352 nt   +upstreamnt  +downstreamnt
atggcccagtggaaccagttacagcagctggagaccaggtatctggagcagctctaccac
ttgtacagtgacagcttccccatggagctacggcagtttcttgccccctggattgagagc
caagactgggcttatgctgccaataaggagtcccatgccacactggtgttccacaacctt
ttgggagagatagatcagcagtatagccgtttcctgcaggagaacaatgtactctaccag
cataacctgcgcaggattaaacagcatctgcagagcaagtacttggagaagccgatggat
attgcccgcattgttgcccgctgcttatgggaggagcaaaggctcctgcagactgccaca
tctgctgcacaggatggccaggcagcccatcccactgggacggtagtgacagagaagcag
cagatcctggagcacaaccttcaagacatcaggaagcgggtgcaggatatggaacagaag
atgaaaatgcttgagaacttgcaggatgactttgatttcaattataagacattgaaaagc
caaggagagttgtcccaggaccttaatggaaatagccaggcagctgctacaagacagaag
atggctcagcttgaacagatgctgagcgccttggaccagctcagaaggcaaatcgtgaca
gagatgggaggcttgctgacagccatggattacgtgcagaagaacctgacagatgaagaa
ctagctgactggaagagaagacagcaaattgcctgcattggaggtccacctaacatctgc
ctggatcgcctcgaaacatggatcacatccttggctgagtcacagctccagattcgtcag
cagatcaaaaagttggaggagcttcagcagaaggtgtcctacaaaggagaccccatcatt
cagcaccggcccgccctggaagagaagattgtggacttgttcagaaacctgatgaagagt
gcttttgtggtggaaagacagccttgtatgcccatgcatccagacagacctctggttatc
aaaacaggagtgcagttcacaaataaagtcaggttactggttaagtttcctgaactcaat
taccagctgaaaattaaagtttgcattgacaaggaatctggtgatgtggctgcaattcga
gggtcacggaagtttaacatccttggcacaaacacaaaagttatgaacatggaggaatcc
aacaatggcagcctgtcagcagagtttaaacacttgaccctgagagaacagaggtgtgga
aatggtggccggaccaacagtgatgcctctctgattgtcacagaggagctgcatcttatc
actttcgagacagaagtatatcaccaaggcctgaagatagatctggagactcattccctg
cctgtggtagtcatttcgaacatctgccagatgcccaacgcctgggcttccatcctgtgg
tacaatatgctcactaaccacccaaagaatgtaaacttctttaccaagcctccagtgggg
acatgggaccaggtggctgaggtgctaagctggcaattctcctccaccaccaagagaggc
ctgaccattgaacagctcaccacactggctgagaaattactagggccttgtgtcaactac
tctggctgtcagatcacctgggccaagttctgtaaggaaaacatggctggtaagggcttc
tccttctgggtgtggctggacaacattattgacctggtgaaaaagtatatcctggcactg
tggaatgaagggtatatcatgggctttatcagtaaggagagggagagggccattttgagt
ccaaaacctcccggcacttttctgctgcgcttcagtgagagcagcaaggaggggggcata
acatttacctgggtagaaaaagacatcagtggaaagacccaaatccagtcagtggagccc
tacaccaagcagcagctcaacagtatgtctttcgccgacatcatcatgggctacaagatt
atggatgccacaaacatcctggtttcgcctctcgtctacctctaccctgatatccccaaa
gaggaagctttcgggaaatactgcaggccagaagcggctcctgaaactgagttgggagac
tctacgagcattactcagccgtacttgaagacaaagttcatctgcgtcacaccgtgtccc
tccgtgttcatggacttgccggacagtgagctgcttgggaacggattcccaggcacaaac
tctggaaacaccagtgacctgttccccatgtcgcctcgcacccttgactctctgatgcac
aacgaagctgaagctaatccagggcatttggattcactcactttggacatggatgtagca
tcaccaatgtga

DBGET integrated database retrieval system