KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111660719
Entry
111660719         CDS       T06058                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1-like isoform X1
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal04012  ErbB signaling pathway
slal04068  FoxO signaling pathway
slal04110  Cell cycle
slal04115  p53 signaling pathway
slal04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:slal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    111660719
   04068 FoxO signaling pathway
    111660719
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    111660719
   04115 p53 signaling pathway
    111660719
   04218 Cellular senescence
    111660719
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 111660719
NCBI-ProteinID: XP_023269863
LinkDB
Position
Unknown
AA seq 170 aa
MCRTMAANKWILSTLGNGPARRNLFGPVDRELLQAEYQAALQKDLEEASQRWGYDFLSDK
PLENSDFQWEGIPGTKVPLLYRSCMLGLGQTERLRPAEAKIRSKGERVEPPQSEKENIPG
TPKRYAFNLENLENTPEKRENTGLKRKQTNITDFYQAKRRVVGMPRKSGE
NT seq 513 nt   +upstreamnt  +downstreamnt
atgtgtagaacgatggctgctaacaagtggatcctgagcaccctggggaatggccctgct
cgacgaaacctgtttggcccagtcgaccgagagctgctgcaggcggagtaccaagctgcc
ctgcagaaagacctggaggaggcttcacagcgctggggctacgacttcctctcggacaag
ccactggagaacagtgatttccagtgggagggaatcccaggtaccaaggtgccgctgctc
taccgatcctgtatgcttggtctgggacagacagaacgtctgaggccagcagaggcaaaa
ataaggtccaagggcgaaagggtggagccaccacagagtgagaaggagaacatcccaggt
acaccgaagagatatgccttcaacctggagaacctggagaatacaccagagaaaagagag
aatacagggttgaagaggaaacagacaaacattacagatttctatcaggctaaaagaaga
gtagttgggatgccacgcaaatccggcgagtga

DBGET integrated database retrieval system