KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111660748
Entry
111660748         CDS       T06058                                 

Gene name
tgfa
Definition
(RefSeq) protransforming growth factor alpha isoform X1
  KO
K08774  transforming growth factor, alpha
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal04010  MAPK signaling pathway
slal04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:slal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111660748 (tgfa)
   04012 ErbB signaling pathway
    111660748 (tgfa)
SSDB
Motif
Pfam: EGF Laminin_EGF
Other DBs
NCBI-GeneID: 111660748
NCBI-ProteinID: XP_023269901
LinkDB
Position
Unknown
AA seq 261 aa
MTRIFWDTIFLISGTFSMSVVLNGSLFTFGAGPSNSTIIEARISIDTNSTAAPNTSTSSS
ATTSSASTTPTTTDIPTVKNSLFTFETGQTNSTIIDAGISIATNSSAAPNTSTSSSATVS
SRRTTTTTIATTTTSIPPVKKFVAAAVRSHFDDCPDSHRHFCFHGTCRFLILEETPACVC
HPGFVGMRCEHADLLAVVATNHRQQTVATVLVLCVIGCVLIMVLCTLLHCWWRQDCRRRS
HAHHYVPEKHIASCYPSESVV
NT seq 786 nt   +upstreamnt  +downstreamnt
atgacgcggattttctgggatacaatttttcttataagcggtacttttagtatgtctgtg
gtactcaatggttccctctttacatttggagcagggccgagcaattcaacaattattgaa
gctcgtatttcaattgatacaaactccacggctgctccaaatacctccacaagcagctct
gcaacaaccagcagcgcaagcaccacaccaactacaactgacatccctacggttaaaaat
tccctctttacatttgaaacagggcagaccaattcaacaattattgacgctggcatttcc
atcgctacaaattcatctgcagctccaaacacctcgacaagcagctctgcaacagtcagc
agcagaagaaccaccaccacaactattgcaactactaccaccagcatacccccagttaaa
aagttcgtggctgcagctgttcggtctcatttcgacgactgtccagactcgcaccgccat
ttctgcttccacggcacctgccgcttcctgatattagaggagacgcctgcgtgtgtgtgc
catccaggcttcgtcgggatgaggtgtgagcatgcagacctgctcgctgtagtagcaact
aatcacagacaacagactgttgccacagtgctggtgttgtgtgttattgggtgtgttctg
atcatggtgttgtgtacacttttacattgctggtggaggcaggactgtcgcaggcggagt
cacgcacatcactacgtcccagagaagcacatagcatcttgctatccatctgagagcgtg
gtttga

DBGET integrated database retrieval system