KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111660826
Entry
111660826         CDS       T06058                                 

Definition
(RefSeq) ras association domain-containing protein 1-like
  KO
K09850  Ras association domain-containing protein 1
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
SSDB
Motif
Pfam: RA Nore1-SARAH C1_1 C1_2
Other DBs
NCBI-GeneID: 111660826
NCBI-ProteinID: XP_023270000
LinkDB
Position
Unknown
AA seq 358 aa
MSKCELIELQDLSVNDPIELAAPAARTVHPPVNPGLPCTFHVVRLVGDSVSIEAPGCQTG
EAAGGHDFQPYGYTHLTWCDLCGEFIWGLYKQSLRCTNCSYTCHYRCRPFIQLDCSTDGS
LLTDQADFSDDSIETDTNVDEQIDLGKQQLSVAEIQQKVKEYNAQINSNLYMMVNKDGFY
TGFIKVHFRLVRPISLPPPQSLCSTQEEDQQGRRMKRRTSFYLPKDTAKHLHISSQTRVR
EVIEALLNKFTVVDNPAKFALFERTERQSQVYMRKLSDDQCPLYLRLCAGPSEKVLSLVL
KENETGDVNWDAFSFPELCNFLRILQREEEEHVRQIVKRYALAKEKMKHAMARITTPG
NT seq 1077 nt   +upstreamnt  +downstreamnt
atgtctaaatgtgagctgatcgagctgcaggacctcagcgtaaatgatcccattgagctg
gctgctcctgcagcccgcactgtccatccacctgtgaacccaggtctgccctgcaccttc
catgtcgttcgtctggttggagacagtgtcagcatcgaggcccctgggtgtcagacagga
gaggctgcagggggtcatgacttccagccctatggttacactcatcttacctggtgtgac
ctgtgtggagaattcatctggggtctttataagcagagtttacgctgcaccaactgcagt
tacacttgtcactaccgctgccgaccattcatccagctggactgcagcacagatggaagt
ttgttaacagaccaggcagatttctctgacgactccatcgagacagacacaaatgtggat
gaacagatcgatttgggtaaacagcagttaagtgtcgctgagattcaacagaaggttaag
gagtataatgctcagatcaacagcaatctctacatgatggttaataaagacgggttctac
actggttttatcaaggtccactttcggttagttcggccgatttccctccctcctcctcag
agcttgtgctcgacacaagaggaagatcagcagggcagacggatgaaacggcggacttct
ttctacctccctaaagataccgcaaaacacctgcatataagctcccaaacacgggtacgg
gaagtcatcgaggcgttgctcaacaagttcactgtggtggacaacccagccaagtttgcc
ctgttcgaacgcactgagagacaaagtcaagtgtacatgcgtaaactttctgatgatcaa
tgtccactctacttacgcttgtgtgctggccccagtgaaaaagtcctgagtctggttttg
aaagaaaatgaaacaggggatgtcaattgggatgcatttagctttcctgagttgtgcaac
tttctgcgaatcctgcagcgtgaggaggaagagcatgtccggcagattgtgaagcgctac
gctcttgctaaggaaaagatgaagcatgctatggcaaggattactacacctggttga

DBGET integrated database retrieval system