KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111661316
Entry
111661316         CDS       T06058                                 

Gene name
prkcq
Definition
(RefSeq) protein kinase C theta type
  KO
K18052  novel protein kinase C theta type [EC:2.7.11.13]
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal04140  Autophagy - animal
slal04270  Vascular smooth muscle contraction
slal04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:slal00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    111661316 (prkcq)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    111661316 (prkcq)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    111661316 (prkcq)
Enzymes [BR:slal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     111661316 (prkcq)
Protein kinases [BR:slal01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   111661316 (prkcq)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 Pkinase_C zf-RING_9 C1_2 Zf_RING Kinase-like zf-RING-like PHD APH DZR DUF2318
Other DBs
NCBI-GeneID: 111661316
NCBI-ProteinID: XP_023270599
LinkDB
Position
Unknown
AA seq 719 aa
MSPFLRIGFSKFEMDPGLAYQEEVLNPYCAVHMKEAIDTEKGQVYKQKKPTMYPPWSTTF
DAHIHRGRIMHVMVKDRTAELKSEATVALDSLAARCKKENGKLEIWLELKPQGRLLMEAR
YFLEKSDAAGQTEGDAESEREQDGLFALHQRRGAIKQAKVHVVKCHEFSATFFPQPTFCS
VCKEFVWGLNKQGYQCRQCNAAIHKKCIDKVIAKCTGSAINSKETMIHKERFKIDMPHRF
KVYNYKSPTFCEHCGTLLWGLAKQGLKCEECGMNVHHKCQKKVANLCGVNQKLMAEALAI
IESKQQAKSTRESEIIGREGPVGIGQPGVVRAPSGLIMGLPATATPANKDVQGVSWEGPT
DGSRSVTVALREEEPLYAVPRKDHQPKFTVDDFVLHKMLGKGSFGKVFLAELKKTGQFFA
VKALKKDVVLMDDDVECTMVERRVLSLAWENPFLTHLYCTFQTKENLFFVMEYLNGGDLM
FHIQSCHKFDLQRATFYAAEIICGLQFLHSKGIIYRDLKLDNVLLDSEGHIKIADFGMCK
ENMQEDLRTSTFCGTPDYIAPEILLGQKYNSSVDWWSFGVLLYEMLIGQSPFHGRDEEEL
FQSIRTDNPIYPRWLTKDAKDILVKLFVREPEERLGVKGNIRQHSFFSSTDWISLEQRQV
APPFRPTLSSPSDCSNFDKEFINEKPRLSCADRTLINSVDQTMFRNFSFVNPGMARIAR
NT seq 2160 nt   +upstreamnt  +downstreamnt
atgtcgcctttcctgcggatcggcttctccaaattcgagatggatcccggtctggcttac
caggaagaggtgctgaacccatactgcgccgtccacatgaaggaggccatcgacacagag
aagggccaagtgtacaagcagaagaagcccaccatgtacccgccgtggagcaccacgttt
gacgcccacatccatcgcggtcgcatcatgcacgtgatggtgaaggaccggacggcggag
ctgaagtctgaggccacggtggctctggactcgctggcggcacgctgcaagaaggagaac
ggcaagctggagatctggctggagctgaagccacagggtcgcctgctgatggaggccaga
tatttcctggagaaaagtgatgctgcaggtcagaccgagggagacgccgagtccgaacgg
gagcaagacggtctgttcgccctccatcagcgacgcggtgccatcaaacaggccaaagtg
cacgtcgtcaaatgtcatgaattcagcgccacgttcttcccacagccaaccttctgctcc
gtatgcaaagagtttgtctgggggcttaacaagcagggttaccagtgcagacagtgcaat
gcagctatccacaaaaaatgcatagacaaagtcatcgccaaatgcaccggctcggccata
aacagcaaagaaacgatgatccacaaggaacgcttcaagatcgacatgccgcacaggttt
aaagtctataactacaaaagccccaccttctgtgaacactgtgggactctgctgtggggg
ctcgccaagcaggggctcaaatgtgaggagtgtggcatgaacgtgcatcataaatgtcag
aagaaagtagccaacctctgtggggtcaaccagaaactgatggctgaagctctggccatc
atcgagagcaagcagcaggcaaaaagcaccagagaatctgaaatcattggtcgagaaggt
ccagtaggtattggccagcctggggtggtccgagctccgtccgggttaataatgggttta
ccggccacggctacacctgcaaacaaagatgtgcagggtgtttcatgggagggaccgaca
gacggcagcaggtcggtcaccgtggcgttgagagaggaggagcctctgtacgccgtccca
cggaaggatcatcaacccaagttcaccgtcgatgactttgtcctgcacaagatgctgggg
aagggcagctttggcaaggtgtttctagctgagctgaaaaagacaggccagttttttgca
gtcaaggctctgaaaaaggacgtggtgctgatggacgacgatgtggagtgcactatggtg
gagaggagggtcctgtctttagcctgggagaatcctttcctcacgcacctttactgcacc
ttccagaccaaggagaacctgttctttgtgatggagtatctgaacggaggggatctgatg
ttccacatccagagctgccacaagtttgacttgcaaagagccaccttctatgcagctgag
atcatctgtgggctccagttcctgcactctaaaggaatcatttacagagacctgaagctg
gacaatgtgctgttggactccgagggccatataaagatagcggactttggcatgtgtaag
gagaacatgcaggaagacttgcggacctccaccttctgcgggacgccggactacattgct
cctgagatcctgctgggtcagaagtacaacagctcggtggactggtggtcgttcggagtg
ctgctgtacgagatgctgatcggtcagtctccgttccacggccgagacgaagaggagctg
tttcagtccatacggacggacaaccccatctacccgcgctggctcaccaaagacgccaag
gacattttagtcaagctgtttgtcagagagcctgaggagaggctgggagtgaaaggaaac
atcaggcagcacagtttcttcagcagcactgactggatctccctggagcaacggcaagtg
gcgccacccttcaggccaaccttatcgtcgcccagcgactgcagcaacttcgacaaagag
ttcatcaacgagaagcctcggctgtcatgtgccgaccggacgctcatcaacagcgttgac
cagacgatgttcagaaacttctccttcgttaacccggggatggctcgcattgcgcgctga

DBGET integrated database retrieval system