KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111661549
Entry
111661549         CDS       T06058                                 

Gene name
nfkbie
Definition
(RefSeq) NF-kappa-B inhibitor epsilon
  KO
K05872  NF-kappa-B inhibitor epsilon
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:slal00001]
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    111661549 (nfkbie)
Transcription factors [BR:slal03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Ankyrin only
    111661549 (nfkbie)
SSDB
Motif
Pfam: Ank_2 Ank Ank_5 Ank_3 Ank_4 GILT Svs_4_5_6
Other DBs
NCBI-GeneID: 111661549
NCBI-ProteinID: XP_023270937
LinkDB
Position
Unknown
AA seq 349 aa
MASDDCSKDDLLEFAGENRTDSGIDSYRSMLKSEEPRDPGTDISGPREKFSTVEERLDSA
YGSSSITGESLTELVESCTLSGDQEEQTHSSELSEQEENLLTTITEEGDTFLHLAIIHED
DIIIQHLIELFPKEVLDIQNNLYQSPLHLATYLNLTDVVRSLVEKGASLELQDQDGNTAL
HVACQHGQTDCAREMTKDVSPSKLAPILETQNWRGLACLHLAALNRQHQIMKLLMKKGAD
LNIQEGTSGKTALHLGVELHDIKSVRLLLSRGANVDATMFNGCTPLHLAVGRQDATIANL
LCQSGADTMLRNMEDETALDLADGNDDILALFPFDDIQISGRSVVGVKF
NT seq 1050 nt   +upstreamnt  +downstreamnt
atggcgtcggacgactgtagtaaagatgacttgctggaattcgcaggagagaaccgcaca
gactcgggcattgactcgtaccgctccatgctgaagtcggaggagccccgggatcccggc
acggacatcagcgggccgagggagaagttctccaccgtggaggagcgcctggattctgcc
tacggctcctcgtccatcacgggggagagtctgacagagttagtggagagctgcacgctt
tccggcgaccaggaggagcaaacacacagctctgaactctctgaacaggaggagaacttg
ctcacaactattactgaagagggagacacattcctgcacttagcaatcatccatgaagac
gatatcatcattcagcacttgatagagctattcccaaaagaagtcctggacatccaaaac
aatttataccagagccctttgcacctggccacctatctgaacctgacagatgtggtgagg
agcctggtggagaaaggggccagcctggagctgcaggaccaggatgggaacacagcgctc
cacgtggcctgccagcacggacagacagattgtgccagagagatgaccaaagatgtttcc
cctagcaaactggcgccgatccttgagacccagaactggagaggtcttgcctgtctccac
ttggctgcactgaacaggcaacatcagattatgaagctcctgatgaaaaagggagcggac
ctgaatatccaggaaggaaccagtgggaaaacagctcttcacctcggcgtggagctgcat
gacatcaaatcagtgcgtctgctgctcagcaggggagccaatgtggacgctaccatgttt
aacggctgcacacccctgcatctcgcagtggggaggcaggacgccaccatcgccaacctc
ctctgccagtctggcgccgacacaatgctgcgaaatatggaggacgagacggcactggat
ctggctgatggcaatgatgatattctggctctatttccttttgatgacatccagatatct
gggaggtctgtggtcggtgtgaagttctga

KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111672507
Entry
111672507         CDS       T06058                                 

Definition
(RefSeq) NF-kappa-B inhibitor alpha-like
  KO
K04734  NF-kappa-B inhibitor alpha
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal04210  Apoptosis
slal04620  Toll-like receptor signaling pathway
slal04621  NOD-like receptor signaling pathway
slal04622  RIG-I-like receptor signaling pathway
slal04623  Cytosolic DNA-sensing pathway
slal04625  C-type lectin receptor signaling pathway
slal04920  Adipocytokine signaling pathway
slal05132  Salmonella infection
slal05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:slal00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    111672507
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111672507
   04621 NOD-like receptor signaling pathway
    111672507
   04622 RIG-I-like receptor signaling pathway
    111672507
   04623 Cytosolic DNA-sensing pathway
    111672507
   04625 C-type lectin receptor signaling pathway
    111672507
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    111672507
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111672507
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    111672507
Transcription factors [BR:slal03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Ankyrin only
    111672507
Membrane trafficking [BR:slal04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    111672507
SSDB
Motif
Pfam: Ank_2 Ank_4 Ank_3 Ank_5 Ank Frankia_peptide
Other DBs
NCBI-GeneID: 111672507
NCBI-ProteinID: XP_023285709
LinkDB
Position
Unknown
AA seq 308 aa
MDVHRVSNHNQMDYNHDNMEPKHGKTLPCHEDRFDSGLDSLKEDELVNEFEEMNVDTLEH
TTEEYEPWRNAVTDDGDTPLHLAVIHEATDHALQMIKLSRNHPFLNVQNHQRQTALHLAV
ITEQPQLVEKLLKAGCDPQLADDSGNTALHIACKRGSLACFGVITQNCQRHLTSILSFPN
YNGHNCLHLASINGYISLVENLVKLGADINAQEQCSGRTALHLAVDLQNPTLVRCLLNLG
ADVNCLNYGGFTAYHLTYGRQNEEIRCQLYEKTPQELRQLPESDSDESDMEDLDLSEDEL
YDDIKFGK
NT seq 927 nt   +upstreamnt  +downstreamnt
atggacgtgcacagagtttcgaaccacaaccaaatggattataaccacgacaacatggag
cccaaacacgggaaaacgctgccttgccacgaggaccgttttgacagcggcctggattcc
ctgaaagaggacgagctggtgaacgagtttgaggagatgaatgtggacacactcgagcac
accacagaggaatatgagccttggagaaatgcagtgactgacgatggtgacacgcctctc
cacttggccgtcattcatgaagccactgatcatgccctccagatgatcaagctgtctcgc
aatcaccccttcctcaacgtacagaaccaccagagacagactgccctccatctagcagtg
atcacagagcagccccagttggtggagaaactcctgaaggccggctgcgacccacagttg
gctgacgacagtgggaacacggctctccacatcgcctgcaagaggggttccctcgcctgc
ttcggtgtcattacccagaactgccagcgccaccttacctccatcctgtccttccccaac
tacaatggacacaactgtctccacttggcatctattaatggctacatttcattggtggaa
aaccttgttaagctgggtgcagacatcaacgcacaggaacaatgcagtggacggacggca
ctccacctggccgtggatcttcagaaccccacgctggtccgttgcctcctcaacctcggc
gccgacgttaactgcttgaactacggcggcttcacggcataccacctcacgtacgggcgc
cagaacgaagagattcggtgccagctgtatgagaagacgccgcaggagctgaggcagctg
cccgaaagtgactcagatgagagtgatatggaggacctggacctgtcagaggatgagctg
tatgacgacataaagttcggaaagtaa

KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111673714
Entry
111673714         CDS       T06058                                 

Gene name
nfkbia
Definition
(RefSeq) NF-kappa-B inhibitor alpha
  KO
K04734  NF-kappa-B inhibitor alpha
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal04210  Apoptosis
slal04620  Toll-like receptor signaling pathway
slal04621  NOD-like receptor signaling pathway
slal04622  RIG-I-like receptor signaling pathway
slal04623  Cytosolic DNA-sensing pathway
slal04625  C-type lectin receptor signaling pathway
slal04920  Adipocytokine signaling pathway
slal05132  Salmonella infection
slal05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:slal00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    111673714 (nfkbia)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111673714 (nfkbia)
   04621 NOD-like receptor signaling pathway
    111673714 (nfkbia)
   04622 RIG-I-like receptor signaling pathway
    111673714 (nfkbia)
   04623 Cytosolic DNA-sensing pathway
    111673714 (nfkbia)
   04625 C-type lectin receptor signaling pathway
    111673714 (nfkbia)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    111673714 (nfkbia)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111673714 (nfkbia)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    111673714 (nfkbia)
Transcription factors [BR:slal03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Ankyrin only
    111673714 (nfkbia)
Membrane trafficking [BR:slal04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    111673714 (nfkbia)
SSDB
Motif
Pfam: Ank_2 Ank_5 Ank Ank_3 Ank_4
Other DBs
NCBI-GeneID: 111673714
NCBI-ProteinID: XP_023287323
LinkDB
Position
Unknown
AA seq 318 aa
MDLHRTSILNQMDYSRESKEGKPGQSTDERLDSGLDSLKEEEYQAVAAEIRQLQVNCNAP
QHKQLPAETEELQEWKTQITEDGDTLLHLAIIHEAKDYIRTMIDESKNTDFLNTQNDLRQ
TPLHLAVITSQADVCQHLLVSGCDPTLVDNRGDTPLHIACRHGNLLCFSVITQFCQKEHL
HTVMAACNYNGQNCLHLASVHGFLSLVENMVELGADINAKEQHNGRSALHLAVDQQNLLL
VKLLLKKGADPNLLTSGGHTPYHLTYGYGSFDIREELYSLTNPELRELPDSDSDDSEEEE
DETFDEEVSYDDIHWNGH
NT seq 957 nt   +upstreamnt  +downstreamnt
atggacctccaccggaccagtatattaaaccaaatggattacagtcgggaatctaaagaa
gggaaaccgggtcagtcgacagatgagcggctcgacagcggtctggactcgcttaaagag
gaggagtaccaggctgtggcggccgagatccgtcagctccaggtgaactgtaatgcccca
cagcacaaacaactccccgctgaaaccgaggagctgcaggaatggaaaacacagatcaca
gaggacggagacacgcttctccacctggccatcatccacgaggccaaagactacatcagg
acaatgattgacgagtccaagaacacagacttcctcaacacacaaaatgacctgagacag
acgcctctgcacttagcggtaataacaagccaggcagatgtgtgtcagcatcttctggta
tccggctgtgaccccactctggtggacaacagaggggacacgcctcttcacattgcctgt
cgccatggtaatctgctgtgcttcagcgtcatcacacagttctgtcagaaagagcatcta
cacacggtgatggctgcctgcaactataatggtcagaactgcctccacctcgcctcagtc
catggtttcctctcactggtagagaacatggtggaactaggagctgacattaacgcaaag
gagcaacacaacggtcgcagtgcgctgcatctggcagtggatcaacagaatctcttactg
gtcaaactgctgctgaaaaaaggagcagaccccaacctcctgacctctggtggccacacc
ccctaccacctcacctatggttatggcagttttgacatcagggaagagctgtactcgctg
accaacccagagctgagggaactgcctgacagcgattcagatgacagtgaggaagaggaa
gatgagacgtttgatgaggaggtcagttatgatgacattcactggaatggacattag

DBGET integrated database retrieval system