KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111663653
Entry
111663653         CDS       T06058                                 

Definition
(RefSeq) kit ligand-like
  KO
K05461  KIT ligand
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal04010  MAPK signaling pathway
slal04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:slal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111663653
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    111663653
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:slal04052]
    111663653
Cytokines and growth factors [BR:slal04052]
 Growth factors
  Growth factors (RTK binding)
   111663653
SSDB
Motif
Pfam: SCF SecY VF530
Other DBs
NCBI-GeneID: 111663653
NCBI-ProteinID: XP_023273700
LinkDB
Position
Unknown
AA seq 251 aa
MRKKILKAPCLLLSLFTSLNLCSGKFGTPITDDVSKLSLLKQNIPSDYEIPVSYIPKEVA
GTCWVVLNIYPLEQSLRKLANMFGAISSNKENIIVFIAMLKSLRFTYEHEELETAMQVFQ
CHYQERSLMSSLYFDYIKDVLHAAAQETSGFSCKPPPCLNPTPGNQEDGRRHSWSKRTPL
LLVLIPFTACVVLIVWLVKSGRRLPVCYTENNQMAPSDMIPSVSVSIPLQTLTHAADTQP
AGEAIPEHESG
NT seq 756 nt   +upstreamnt  +downstreamnt
atgaggaaaaaaattttgaaagcaccttgtctcctcttgagtctgttcacaagtttgaat
ctctgctctggaaaatttgggacaccgataactgatgatgtgagcaagctgtcattattg
aagcagaatatcccctctgattatgaaattcctgttagttacattcccaaagaagtggct
ggcacttgctgggtggtattaaatatctatccattagagcaaagtcttcggaagctggct
aatatgtttggtgccatctcctccaacaaagaaaacataattgtcttcattgcaatgctg
aagagtttacgcttcacctatgaacatgaggaactggaaacagcgatgcaagtcttccag
tgtcactaccaggaaagaagcttaatgtctagtctttactttgactacatcaaagacgtc
ttacatgctgccgctcaagaaacatccggcttctcatgcaagccgccaccatgccttaat
ccaacaccagggaatcaggaggacggacgtagacacagctggtcaaagagaacgcccttg
cttctggttctcatccccttcacagcttgtgttgttcttatagtgtggctggtcaagtct
ggcaggcgtttaccagtgtgctacactgaaaataaccaaatggcaccttctgacatgatc
ccaagtgtgtctgtctccatcccacttcaaacactcacccacgctgctgacactcagcca
gcgggggaggcgatccctgaacatgaaagtggatga

DBGET integrated database retrieval system