KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111663680
Entry
111663680         CDS       T06058                                 

Definition
(RefSeq) adiponectin receptor protein 2-like
  KO
K07297  adiponectin receptor
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:slal00001]
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    111663680
SSDB
Motif
Pfam: HlyIII DUF3767
Other DBs
NCBI-GeneID: 111663680
NCBI-ProteinID: XP_023273747
LinkDB
Position
Unknown
AA seq 378 aa
MSPREKGDTPTSGSSTSHLSTAECPSHNGSVPECEEERRINEEDDRGREGGEEKDWEEDE
RSSDEGFMGMTPLLQAHHAMERMEEFVHKVWEGRWRVIPHDVLPDWLKDNDFLLHGHRPP
MPSFRACFKSIFRIHTETGNIWTHLLGCLFFLCLGLMYMFRPNMSFVAPVQEKVVIGMFF
LGAILCLSFSWLFHTVYCHSEGVSRVFSKLDYSGIAFLIMGSFVPWLYYSFYCSPQPCFI
YLIVVCILGLAAITVSQCDFFATPQYRGVRAGVFVGLGLSGVVPTLHFVISEGLIKATTM
GQMGWLLLMATLYITGACLYAARIPERFFPGKCDIWFHSHQLFHILVVAGAFVHFHGVSN
LQEFRYTAGAGCAEDGTL
NT seq 1137 nt   +upstreamnt  +downstreamnt
atgagtccccgggagaaaggagacacgcccacctcaggttcttcaaccagtcacctcagt
accgcagagtgcccctcacacaatgggagtgtccctgagtgcgaagaggagagaagaata
aatgaagaggatgacagaggaagagaaggaggagaggagaaagactgggaagaggatgag
aggagcagcgatgaaggtttcatggggatgactccattactgcaggctcaccatgccatg
gagaggatggaggagtttgttcacaaggtgtgggaaggccggtggcgcgtcatacctcat
gacgtgctccctgattggctcaaggacaacgacttcctgcttcatgggcacaggccaccc
atgccttcgtttcgcgcttgcttcaagagcatcttcagaatccacacagagacgggaaac
atctggacacacctgctaggatgtttgtttttcctctgtctgggtctcatgtacatgttc
aggcccaacatgtcgttcgtggctcccgtccaggagaaggttgtgatcgggatgtttttc
ctgggagccatcctctgcctctccttctcctggctcttccacacagtctactgccactct
gagggcgtctccagagtcttctccaagctggactacagtgggatcgccttcctgatcatg
ggctcattcgtcccctggttgtactactccttctactgctcccctcagccttgcttcatc
tacctgatagtggtgtgtatactggggcttgccgccatcaccgtctcccagtgcgacttc
ttcgccacaccgcagtacagaggagtcagagcaggagtgtttgtgggtttgggtctgagc
ggcgtggttcccaccctacactttgtcatcagcgagggtctgatcaaagcgaccaccatg
ggtcagatgggctggttgctgctcatggcgacgctctacatcaccggagcctgtctgtac
gccgctcgtatccctgagaggttcttccctggcaagtgtgacatctggttccactcccac
cagttgttccacatcttggttgttgccggggcttttgttcatttccacggtgtatccaac
ctacaggagtttcgctacacggcgggagcgggctgcgctgaggacggcaccctttaa

KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111667831
Entry
111667831         CDS       T06058                                 

Gene name
adipor1
Definition
(RefSeq) adiponectin receptor protein 1
  KO
K07297  adiponectin receptor
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:slal00001]
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    111667831 (adipor1)
SSDB
Motif
Pfam: HlyIII
Other DBs
NCBI-GeneID: 111667831
NCBI-ProteinID: XP_023279445
LinkDB
Position
Unknown
AA seq 376 aa
MSGRNGSASDADCRISEDCHVPDVELMELGPLLEEGGGRQAAAKGVHPEGAAMLADEEEE
DDEVGEVLTLPLQAHHAMEKMEEFVHKVWEGRWRVIPFHVLPEWLKDNDYLLHGHRPPMP
SFRACFGSIFRIHTETGNIWTHLLGLILFICLGTLTMLRPNMYFMAPLQEKVVFGMFFLG
AVLCLSFSWLFHTVYCHSEKVSRTFSKLDYSGIALLIMGSFVPWLYYSFYCSPQPRLIYL
TIVCVLGIAAIIVAQWDRFSTPRHRPTRAGVFMGLGLSGIVPTMHFTIEEGFVKATTVGQ
MGWFYLMGAMYITGAGLYAARIPERYFPGKCDIWFHSHQIFHVLVVAAAFIHFYGVSNLQ
EFRYGLEGGCTDDTLL
NT seq 1131 nt   +upstreamnt  +downstreamnt
atgtcaggccgaaacgggtctgcaagtgatgcagactgccggatctctgaggactgccat
gtcccagatgttgagttgatggagctggggccgctgctggaggaaggaggggggcgccag
gcagcagctaaaggcgtccatccagagggagctgccatgcttgctgatgaggaagaggag
gatgatgaggtgggagaggtccttaccttaccacttcaggctcaccacgccatggagaag
atggaagagtttgtacacaaggtttgggaggggcgctggagggtcatcccttttcatgtc
ctgccagagtggctaaaggacaacgattacctcctgcatggacatcgacccccaatgccc
tcctttcgagcctgttttggaagcatcttcagaattcacactgagacaggaaacatctgg
actcacctgttagggctgatcttattcatttgtctgggcacgttaaccatgctgcggccc
aacatgtattttatggccccactgcaagagaaagtggtgtttgggatgttcttcctggga
gctgtgctctgcctcagcttctcctggcttttccatacagtctactgccactctgagaaa
gtgtctcgcaccttctccaaacttgactactcgggcattgccctcctgatcatgggctct
ttcgtgccctggctgtactactcgttctattgttcccctcagcctcgacttatctacctc
accattgtatgtgtcctcggcattgccgccatcatagtggcccagtgggaccgcttctcc
acacctcgtcacaggccaacaagagcaggtgtgttcatgggtctgggactaagcggcatt
gtccccaccatgcacttcaccatcgaggagggttttgttaaggccaccactgtcggccag
atgggttggttctacttgatgggagcgatgtatatcactggtgctggtctgtatgcagct
aggatccctgaacgctatttccctggcaagtgtgacatctggttccattcccatcagatt
tttcatgttctggtcgtggcagcagcgttcatccatttctacggcgtttccaacctgcag
gagtttcgctacggcctcgagggaggatgcacagatgacactctactctga

DBGET integrated database retrieval system