KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111664165
Entry
111664165         CDS       T06058                                 

Definition
(RefSeq) adenylate cyclase type 3-like
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal00230  Purine metabolism
slal01100  Metabolic pathways
slal04020  Calcium signaling pathway
slal04114  Oocyte meiosis
slal04261  Adrenergic signaling in cardiomyocytes
slal04270  Vascular smooth muscle contraction
slal04371  Apelin signaling pathway
slal04540  Gap junction
slal04912  GnRH signaling pathway
slal04914  Progesterone-mediated oocyte maturation
slal04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:slal00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    111664165
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    111664165
   04020 Calcium signaling pathway
    111664165
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    111664165
  09144 Cellular community - eukaryotes
   04540 Gap junction
    111664165
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    111664165
   04914 Progesterone-mediated oocyte maturation
    111664165
   04916 Melanogenesis
    111664165
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    111664165
   04270 Vascular smooth muscle contraction
    111664165
Enzymes [BR:slal01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     111664165
SSDB
Motif
Pfam: Guanylate_cyc AC_N HNOBA DUF1053 fn3_4 OPA3 DUF3446 Peptidase_S49_N DUF4400
Other DBs
NCBI-GeneID: 111664165
NCBI-ProteinID: XP_023274418
LinkDB
Position
Unknown
AA seq 1125 aa
MPRNRAFSEPEYSAEYSADCSVTLPSDPGQAVGRTHEVTVRSSGCCLCLPRFMRLTFAPE
SLENLYQTYFRRQRHETLLVLVVFAALFDSYIIIMCAVVYTTDKLASVLVASVGLAADII
LYLLCRFGLLPDRISRRVVPYALWVLIAAQIFCYLGLNYARFHQASDTVGWQAFFSFSFF
LTLPLRLTPIVLITTVSCGVHTLVLGVTIAQHQQEEVQGAALGRQLLANIVIYVCAITVG
VMSYYMADRKHRKAFLEARQSLEVKLNLEEQSQQQERLLLSILPKHIADEMLQDMKKEPS
QKEMQQFNTMYMYRHENVSILFADIVGFTQLSSSCSAQELVKLLNELFARFDKLAAKYHQ
LRIKILGDCYYCICGLPDYREDHAACSIMMGLAMVEAISYVREKTQTDVDMRVGVHSGTV
LGGVLGQKRWQYDVWSTDVTVANKMEAGGIPGRVHISQSTMECLHGEFDVEPGNGGDRCD
YLRERGIDTYLVVVPKGPVGKNGINGVKLSVTSSNGNSPLLINTTECNGSANTACTTPEE
PDELDTRVVNPSFPNPRRRLRLRDLAERVIDAQENEQELNKLLNEALLERETVQALKGKH
TNRLSLRFVDPDLETRYSVEKEKQSGAAFCCSCVVLLFTAAMEALIDPWLIANYITFAVG
EVLLLILTICSLAAIFPRVFPKKLVSFSTWIDHTRWARNTWAMAAIFILTMADIMDMLSC
LPRVPDSGSTTVAPSSSSSSSSSTRSGPDGCLGNPKYYSYIAVLALMATTMLVQVSHMVK
LTLMLLITVATGIVNIYSWRDIFDRYDMARFQDYRSYLVPSKFTMTIMIFIMMVSFYYFS
RHVEKLARTLFLWKIEVHEQKEKVYEMRRWNEALVTNMLPEHVARHFLGSKKRDEELYSQ
SYDEIGVMFASIPNFSDFYTEESINNGGIECLRFLNEIISDFDSLLDEPQFRCITKIKTI
GSTYMAASGVTPDVSNGYTCMKKEEQSDRERWQHLADLADFALAMKVTLMNINYQSFNNF
MLRIGLNKGGVLAGVIGARKPHYDIWGNTVNVASRMESTGVMGNIQVVEDCYNILKEYGF
RFVRRGPIFVKGKGELLTYFLKGRDKQGSFINGSSVTLPHQVVDS
NT seq 3378 nt   +upstreamnt  +downstreamnt
atgccccggaaccgagccttctccgagcccgagtactcggcagagtattcggcggactgc
tccgtgacgctgccctcagaccccgggcaggcggtggggcggacacatgaggtcacggtg
cggagctcgggatgctgcctctgtctgccgcggttcatgcgcctcaccttcgcgcccgag
tctctggagaacctgtaccagacctacttcaggcggcagagacacgagaccttgctggtg
ctggtcgtgttcgccgccctcttcgacagctacatcatcatcatgtgtgccgtggtctac
accactgacaagctggcgtctgtcctagtggcctcagtgggactggctgcagatattatc
ctctacctgctgtgccgcttcggcctgctgccagaccgcatctccagacgggtggtgccc
tacgccctgtgggtgctcatagcggcgcagatattctgctacctgggtctgaactatgct
cgcttccaccaggccagcgacaccgtgggttggcaggccttcttcagcttctcctttttc
ctgactctgcctctgaggctgacccccatcgtgctcatcaccactgtgtcctgcggggtc
cacactttggttctgggcgtcaccatcgcccagcatcagcaggaggaggtccagggggct
gcgcttggcagacagctgctggccaacatcgtgatctacgtgtgtgcgatcaccgtgggc
gtcatgtcgtactacatggctgacaggaagcatcggaaggccttcctggaggcgaggcag
tcactggaggtcaaactcaacctagaggagcagagccagcaacaggagcgtctgctgctc
tccatcctccccaagcacattgcggacgagatgttgcaggacatgaagaaggagcccagt
cagaaagagatgcagcagttcaacaccatgtacatgtacagacatgaaaacgtcagtatt
ctgtttgcagacatcgtgggcttcacccagctgtcatcgtcctgcagcgctcaggagctg
gtcaaactgctcaacgagctgttcgctcgcttcgacaaactggccgcaaaatatcaccag
ctgaggatcaagatcctgggagactgctactactgcatctgcggcctgccggactacagg
gaggaccacgccgcctgctccatcatgatgggcctggccatggtggaggccatctcgtac
gtcagagagaaaacccagaccgacgtggacatgagggtgggagttcacagcggcaccgtg
ctgggaggagtgctgggtcagaaacgctggcagtacgacgtctggtccaccgacgtcact
gtggccaacaagatggaggctggagggatcccaggtcgcgtccacatctctcagagcacg
atggagtgtcttcatggagagtttgacgtggagcctgggaacggaggcgaccgctgtgac
tacctgagggagagaggcatcgacacctacctggtggtcgtccctaaagggcctgtggga
aagaatggcatcaacggtgtaaagctgtctgtgacctcgtccaatggaaactctccgctg
ctgatcaacaccacagagtgtaacggcagcgctaacacagcctgcaccacgccggaggag
ccagacgagctggacaccagggtggtgaatccgtccttccctaacccgcggagacggctg
cggctgcgggacctggcggagagagtgatcgatgctcaggagaacgagcaggagctcaac
aaactgctgaacgaggctctgctggagagagagacggtgcaggctttgaaggggaaacac
accaacaggctctccctgaggtttgtggatccggacctggagactcgttactccgtggag
aaggagaagcagagcggagcggccttctgctgctcctgtgtggtcctgctcttcactgca
gccatggaggcgctcatagacccctggctgattgcaaactacatcacctttgcagtggga
gaagtcctgctgctcatcctgaccatctgctctctggccgccattttccccagagtcttt
cccaagaagctggtgtcgttctccacctggatcgaccacacccgctgggcccggaacacc
tgggccatggcggccatcttcatcctcaccatggccgacatcatggacatgctgagttgt
ctccctcgagtcccagactcaggtagcaccactgtggctccctcctcttcctcctcctcc
tcctcctccactcggtccggccctgacggttgcctgggcaaccccaaatattacagctac
attgctgtgcttgctctgatggctaccaccatgctggtccaggtcagtcacatggtcaag
ctcacactgatgctgctcatcaccgtggccaccggcatcgtgaacatctacagctggagg
gacatcttcgaccgctacgacatggcccgtttccaggactacaggtcgtacctggttccc
tccaaattcaccatgaccatcatgatcttcattatgatggtcagcttctattacttctcc
cgacatgtggagaagctcgcccgcaccctgttcctgtggaagatcgaggtccatgagcag
aaggagaaggtgtacgagatgaggcgctggaacgaagcgctggtgaccaacatgctgcct
gaacacgtggcccgacacttcctgggatccaagaagagggacgaggagttgtacagtcag
tcctacgacgagatcggagtcatgttcgcctcgatccccaacttctctgacttctacaca
gaggagagcatcaacaacggaggcattgagtgtctgcgcttccttaacgagatcatctct
gactttgacagtctgctggatgagcctcagttccgctgcatcactaaaatcaagaccatc
ggcagcacctacatggcagcgtcaggtgtcaccccagatgtcagcaatggctacacctgc
atgaagaaggaggagcagtcggacagggagcgctggcagcacctggcggacctggcggac
ttcgctctggccatgaaggtcacactcatgaacatcaactaccagtcgttcaacaacttc
atgctgcgcattggtctgaataagggcggagtcttagccggagtgatcggtgcccggaaa
ccccactacgacatctggggcaacactgtgaatgtggccagtcgcatggagtccacaggg
gtgatggggaacatccaggtggtggaggactgctacaacatcctgaaggagtacggtttt
cgcttcgtgaggcgggggccgatctttgtgaaggggaagggggagctgctcacctacttt
ctgaagggaagagacaaacagggctccttcatcaacggctcctccgtcactctgcctcac
caggtggtggacagctag

DBGET integrated database retrieval system