KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111665658
Entry
111665658         CDS       T06058                                 

Gene name
atf6b
Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-6 beta
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal04141  Protein processing in endoplasmic reticulum
slal04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:slal00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    111665658 (atf6b)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    111665658 (atf6b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:slal03000]
    111665658 (atf6b)
Transcription factors [BR:slal03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    111665658 (atf6b)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 SUIM_assoc YabA bZIP_Maf MCU
Other DBs
NCBI-GeneID: 111665658
NCBI-ProteinID: XP_023276497
LinkDB
Position
Unknown
AA seq 733 aa
MSTELLSELDSRFFADNLLTSEDWDACLYQCDSMEEGEDADLSRGLKYDTSFDNDLVLTL
DPDNPTSPWRHSDENLLTGDTPVIKNEMTITQPLPVEMLFQVKAEPLSPASSLGSDCSVS
SPDPQITVKGENPPTPPYMYGDVLSPPLGSMEVTVATTAVPPPQTPLPALTQTQLQTPLT
TPIPAVISGLQTQAAVLPSSATLKASTIMNTKPPIQPRPVCVTTLPVPQTPAPAKTLILQ
GLPSMDQTRPVVLSQSVCLGSAPAIVKMEPVSPSIPQHCSSPTAPPTSKPIVPATTTLPG
NNSSDIDMKVLKRQQRMIKNRESACQSRKKKKEYLQNLEAQLREAQQENERLRRENQALR
ERLAGKEGSDSASNKRAVCVMAVLLFMTFSFGPVSITDKKLSTGLQDSVMSYTGRRLLEI
EQQQQQQQQQQQPVAAQPPSRVEDKTETEEDGGEAERYAPESYHFRNLSDVFSDMKDLVL
QDIDRYFSSSDCRQFNRSESLRLADELRGWVHRHQIDRKKSGGKPKIAKKAKIAQKAQLR
KTNFSRYLPIQAHRSIESQLQVLPGPEVTYSDFLDAIDRREDTFYVVSFRRDHLLLPAIS
HNKTSRPKMSLVMPAMSVNESLYNSSQGYEMMMQVDCEVMDTRIVPIKSSAVPPSLRDPP
PPPXXXXXXXXXXXXPHHHHHHHGNHTSLRGRHQHHPSSSSSPSSSASSQSPRQPLPARR
RTAEYFISQSEGV
NT seq 2202 nt   +upstreamnt  +downstreamnt
atgagcacggaattactatcggagttggacagccgattcttcgctgataaccttctgacc
agcgaagactgggatgcctgcctgtaccagtgtgacagcatggaggagggagaggacgcg
gacctcagccgtgggttgaaatacgacacgtcgttcgacaatgaccttgtgctcaccctc
gatcctgacaaccccacatcaccatggcgacacagtgacgaaaacctgctcacaggcgac
acgccggtgataaaaaatgaaatgacgatcactcagccgttaccagtggaaatgttgttc
caggtgaaagcagagcctctctctccggcatcttcactcggctccgactgctccgtatcg
tcaccagacccacagatcacagttaagggcgaaaaccctccgactcctccgtacatgtat
ggagacgtgctgtctcctccgctgggatccatggaggtaaccgtggcaacaacggccgtg
cccccaccgcagacgccgttacctgctctgacacagacgcagctgcagacgccgttaacg
acaccgattcctgcagtcatcagtggattacagacacaggctgcagtcctgccaagttca
gccacattaaaggccagcaccatcatgaacacaaaacctcccattcagcccagacctgtg
tgtgtcaccaccctacctgtccctcagaccccggcaccagccaagaccctcatactgcag
ggcctcccctccatggaccagaccagacctgtcgtcctgtctcagtccgtctgcctcggc
tcggctccggccatcgtcaaaatggagccggtctctcccagcatcccccagcactgttcc
agccccacagccccacccaccagcaaacccatcgtcccggcgaccacgactttacccggc
aacaactccagtgatatcgacatgaaggtgttgaagcggcagcagaggatgataaagaac
cgagagtcggcctgccagtcgaggaagaagaagaaggagtacctgcagaacctggaggct
cagctcagggaggctcagcaggagaacgaacgactccgcagggagaaccaggcgctgagg
gagagactggctgggaaagagggcagtgactctgcgagtaacaagagggccgtttgtgtc
atggccgttctgctcttcatgaccttcagcttcggacccgtcagcatcacagacaagaag
ctgtcgacgggtctacaggacagcgtgatgtcgtacacaggacgacggctgctggagatc
gaacaacaacagcaacagcagcagcaacagcaacagccggtggctgctcagcctccaagc
agagtggaggacaagacggagacggaggaggacggaggagaggcagagagatacgctcca
gagtcgtatcacttcaggaacctgagtgacgtcttcagcgacatgaaggacctggttctc
caggacatcgatcgttacttctcctcctccgactgcagacagttcaaccgctctgagtcc
ctcaggctggcagacgagctgagaggttgggttcaccgacaccagatcgacaggaagaaa
tctggaggaaaaccaaagatcgccaagaaggccaaaatcgcccagaaagctcagctgagg
aagacaaacttctccagatatctgcccattcaggctcatcgctccatagagagtcagctg
caggtgcttcccggtccggaggtcacgtacagcgacttcctggatgccatcgaccgcagg
gaggacacgttctacgtcgtctctttcagacgggaccacctgctgctaccagccatcagc
cacaataagaccagcagacccaaaatgtctctggtgatgccggccatgtccgtcaacgag
agtctgtataactcctctcagggctacgagatgatgatgcaggtcgactgtgaggtcatg
gacacccgaatcgtccccatcaagtcctccgctgtcccgccatccctccgcgaccctccc
ccacctccccnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnccctcaccaccaccac
catcaccatggcaaccacacctcgctccgaggacgacaccagcatcacccatcctcttcc
tcctcaccgtcctcctccgcctcctcccagtctccgaggcaacctttacccgcccgccga
cggacagctgaatatttcatcagccaatcagaaggggtgtga

DBGET integrated database retrieval system