KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111665947
Entry
111665947         CDS       T06058                                 

Gene name
ppargc1a
Definition
(RefSeq) peroxisome proliferator-activated receptor gamma coactivator 1-alpha isoform X1
  KO
K07202  alpha peroxisome proliferator-activated receptor gamma coactivator 1-alpha
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal04371  Apelin signaling pathway
slal04910  Insulin signaling pathway
slal04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:slal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    111665947 (ppargc1a)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    111665947 (ppargc1a)
   04920 Adipocytokine signaling pathway
    111665947 (ppargc1a)
Mitochondrial biogenesis [BR:slal03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    111665947 (ppargc1a)
SSDB
Motif
Pfam: RRM_1 SR-25
Other DBs
NCBI-GeneID: 111665947
NCBI-ProteinID: XP_023276872
LinkDB
Position
Unknown
AA seq 1280 aa
MAWDRCNQDSVWRELECAALVGEDQPLCPDLPELDLSELDVSDLDADSFLGGLKWYSDQS
EIISTQYGNEASNLFEKIDEENEANLLAVLTETLDSIPVDEDGLPSFEALADGDVTNASD
RSCPSSPDGSPRTPEPEEPSLLKKLLLAPANSQLSYNQYTGGKAQNHAASSNHRIRPPPA
VVKTESPWNGKARGGSSQQNRPVRRPCTELLKYLTATDDILLHTKASEAKSTWGGASGRD
KSGLGLGASSSSSSPSSSSTSSFSSLSSTSSSSSSTTSKKKSAVPSQQQQQQQQQQLQQH
HQRGESRAAGECSVAGVGAGKWQRCTHDGGVEESEGASIPVGHRTSTCGHARPKLEHGPP
SEEGRPPGNVGRLAAARFIRYMHSYSLPPREVSHSCEHCREAAGATQASEGFGRQGRSSS
SGASRAPHRHITVTIRKRDEKPGHPLLSQLLTSKQRPAQYRAHLPPPKITPLPSTQGKLA
GKRSESPAQAVSKVEEEEFRGTTDFRNRGVSQAEEPESEPLLSPLALDLESWVSQADPVL
DMGFGLELGWPIQGGYGEDVDHDDDDDGVDDDDDDHVTGSPAAVLSQGPPSPLFPDTRIA
EPTPPCIIQGQGHPHRQALSEHPDDQGLPLLAKPTTLPLPLTPESPNDHKGSPFENKTIE
RTLSVEIAGTPGLTPPTTPPHKASQENPFKASLKTKLSSCSSSALACKRARLSELGPGAL
APAPGASGGGPNRKGPEQTELYAQLSKASTALPYSATQHTVVGGLEEHRSTSNNKRAAPR
GYSDHDYCQASASTKKDSGAATVTMTTAAEMTVTSGATAAPMPTTGTVEDRHVECKDSAM
PPSSSSSSSSCSPSSASSGPLAKQQNFASVDGEAVRVQGLGKQTLTQTTQIPSREATTDR
DQEHPSATSRKLLCDQEIRAELNKHFGHPLQALYSQGGQEREPGSKPNKSAAPQSLKEGE
DEYLSQKLPGSIYLHPGFLPFHDELELGEGRESRFLYPWEGTPLDLLFDCPPCSPSCSPP
SSCSPSRGSVSPPSSLLLSPGRPFCWTSGGSRSRSRSHSGSRSSSSHYRRRSLSSSPDRR
PSSWSRHNTDSSTFRSRTYKSPHPQSRSPLSRRPRYDSYEEYQHERLKREEYRRDYEKRE
FERAEQRERQRQKAIEERRVVYVGRLRSNCTRTELKRRFEVFGEIEECAVNLRDDGDNFG
FITYRYTCDAFAALENGHTLRRSNEPQFELCFGGQKQFCKSHYTDLDSHSDDFDPASTKS
KYDSMDFDSLLREAQRSLRR
NT seq 3843 nt   +upstreamnt  +downstreamnt
atggcgtgggacaggtgtaaccaggactcggtgtggagagaattagagtgtgctgccttg
gttggtgaagaccagcccctctgcccagacctccctgaacttgacctctcagagctggat
gtcagtgacttagatgcagacagcttcctgggtggcctcaaatggtacagtgaccaatca
gagatcatttccactcagtatggcaatgaggcatccaatctttttgagaagatagatgaa
gaaaatgaggccaacttgctggcagtgcttacagagaccctggacagcatcccggtggat
gaggacggattgccttcgtttgaggccctggcagatggggacgtgaccaatgccagtgac
cggagctgtccctcctcccccgacggctcgccgcgcaccccagagcctgaggagccttcc
ctgctgaagaagctccttctggcacccgcaaactcccagctcagctataatcaatacaca
ggtggcaaggcacagaaccatgcagccagcagcaaccaccggatcagaccaccacctgcc
gtcgtcaagacggagagcccctggaatggcaaagcaagagggggctccagccaacagaac
cgcccggtgaggcggccttgcactgagctgctgaaatacctaacggccaccgatgacatc
ctgctccacaccaaagccagtgaagccaagagcacgtggggcggcgccagtggcagggac
aagagtggcctgggtcttggcgcctcttcctcctcctcgtcgccatcctcgtcatccacc
tcctcgttctcctccctctcctccacctcctcttcatcttcctccaccacctccaagaag
aagtcagctgtgccatctcaacaacaacagcagcagcagcagcagcagctgcagcagcat
caccagcgaggtgagagccgggctgcaggcgagtgtagtgtggctggtgttggggctggg
aagtggcagcgttgcactcacgatggcggtgttgaggagtcagagggtgcttctatccct
gtcggccacagaacctccacctgcggccatgcccgccccaaactggagcacgggccgccc
agtgaagaaggaaggccgccaggcaatgtgggccgcctggccgccgctaggtttattagg
tatatgcattcttattccctccctcccagagaggtgagtcacagctgtgagcattgccga
gaggctgcgggcgccactcaggctagtgagggctttggcaggcaaggccgtagtagcagt
agtggtgccagccgtgcaccacataggcacatcacagtgactattaggaaaagagatgag
aagccggggcaccccttacttagccagctgctcacctccaaacagaggcctgctcagtat
cgggcccaccttcccccacctaagatcacccctttacccagcactcagggcaaattagca
ggtaagaggtctgagagtccagcccaggctgtttcaaaggtggaggaggaagagttcaga
gggaccactgattttagaaaccggggagtaagtcaggctgaagagcctgagtcagagccc
ctgttgtcacctcttgccttagacctagagagctgggtcagccaggcagatccagtgcta
gacatgggctttggactagagctggggtggccaatccaggggggctatggggaggatgtt
gaccatgatgatgatgatgatggtgttgatgatgatgatgatgaccatgtcacgggcagc
cccgcagcggtgctctcacagggcccaccaagcccactcttcccagatactagaattgca
gagcccacccctccctgcatcatacaagggcaagggcacccacacaggcaggcactcagc
gagcaccccgacgaccagggcctcccgttgttagccaaaccaaccaccttgccacttcct
ttgaccccagagtctccaaatgaccacaagggatcaccgtttgagaacaaaaccattgaa
cgcacattaagcgtggagattgctggaaccccaggtctgacaccacctaccacgccccca
cacaaagccagtcaagagaatcctttcaaagcatcgctcaaaaccaagttgtcttcatgt
tcctcctcagctttggcatgcaaaagagccaggttgagcgagttgggccccggcgctctg
gccccggccccaggtgcctcaggcgggggccccaacaggaagggtcccgaacagactgag
ctttatgcccagctgagcaaagcgtccaccgccctcccttactccgccacccaacacaca
gtggtgggcggccttgaggagcatcgcagcactagcaacaataagcgggcggcgccccgt
ggctacagtgaccatgactattgccaagcgtcagctagcactaagaaggacagcggcgca
gccactgttaccatgactacagcagcggaaatgacagtcacctcgggtgccactgctgct
cccatgcctactacaggcacagtggaggacaggcatgtcgaatgtaaggactcagccatg
ccaccatcctcttcatcatcttcatcttcttgctctccatcatcagcttcatctggtccg
ttggctaagcagcagaattttgcctctgtggatggagaagcagtccgggtccaggggtta
gggaagcagacccttacacaaaccacccagatcccctcacgagaggccactactgacagg
gaccaagaacacccttctgccaccagccggaagctcctgtgcgaccaagaaattagagca
gaactcaacaagcactttggccaccctttacaagccctctacagtcagggtggtcaggaa
agagaaccaggcagcaaaccgaacaagtctgcagcccctcagtccctcaaggagggagag
gacgagtacttatcccagaagctgcctggctccatttacctgcatccaggcttcctgccc
ttccacgatgaactagagctgggtgagggccgtgagagtcgcttcctctatccatgggag
ggcacccctctggacctactctttgactgccccccctgctctccctcctgttccccacca
tccagctgctccccttcgcgaggctccgtctccccaccttcctccctcctcctctctcca
ggcagacctttctgctggaccagcggcgggtcccgctcccgttctcgttcccactccggc
tcccgcagctcctcctcacactaccgaaggcgctctctctccagctcacctgacagacgc
ccctcttcctggtctcgtcacaacacagattcaagcacttttcgctccaggacttacaag
agcccccaccctcagtctcgatctcctctcagccgcaggccaaggtatgacagctatgag
gagtaccagcacgagaggctgaagagggaggagtaccgccgggactacgagaagcgggag
ttcgaaagagccgagcagagagagaggcagaggcagaaagcaatagaggagagacgggtg
gtgtacgtggggcgactgaggtccaactgcacccggacggagctgaagcgccgctttgaa
gtctttggcgaaattgaagaatgtgcagtgaacttgagggacgatggggacaattttggc
ttcatcacgtaccgctacacttgtgacgcctttgccgcccttgagaacggacacacctta
cgcaggtcaaacgagcctcagttcgagctgtgctttggcggacaaaagcagttctgcaaa
tcacattacacagacttggattcccattcggacgactttgatccagcctccacaaaaagc
aagtatgactccatggattttgacagcttgctgagggaggcccagcgcagcctgagaagg
taa

DBGET integrated database retrieval system