KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111666877
Entry
111666877         CDS       T06058                                 

Definition
(RefSeq) uncharacterized protein LOC111666877
  KO
K03158  tumor necrosis factor receptor superfamily member 1A
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal04010  MAPK signaling pathway
slal04060  Cytokine-cytokine receptor interaction
slal04150  mTOR signaling pathway
slal04210  Apoptosis
slal04217  Necroptosis
slal04920  Adipocytokine signaling pathway
slal05132  Salmonella infection
slal05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:slal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111666877
   04150 mTOR signaling pathway
    111666877
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111666877
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    111666877
   04217 Necroptosis
    111666877
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    111666877
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111666877
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    111666877
Cytokine receptors [BR:slal04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   111666877
CD molecules [BR:slal04090]
 Proteins
  111666877
SSDB
Motif
Pfam: Death EphA2_TM TMEM154 Adeno_E3_CR2 DUF2207 Insulin_TMD Orf78
Other DBs
NCBI-GeneID: 111666877
NCBI-ProteinID: XP_023278152
LinkDB
Position
Unknown
AA seq 214 aa
HVSVFFSHVSPWDPREAPDKGNEFLINIIVGVVSVGFLLLVLVVLITYIVTKRCTQRNLQ
KPPSQPSDVSPDSCEQVLICREEPLDNSSVKAISQSPVSEQQPSNLPDCVPLEIKITDLI
YTVLDLVPVLQVKQLVRTLGVMDTEIEQAEMDHRSCREAHYQMLRVWAERGSRAGGGGRG
GMLHWSLMQELSDILRKMHLGRAAEELETKYGIQ
NT seq 645 nt   +upstreamnt  +downstreamnt
catgtatccgtctttttttctcatgtgtccccttgggatcctcgtgaagctcctgacaaa
ggaaatgaatttctcataaacataattgttggagttgtatctgtgggttttctattgttg
gtgttggtggttcttatcacctacatagtcacaaaaaggtgcacccagaggaatttgcaa
aaaccgccttcccaaccgtctgatgtttccccggactcttgcgagcaggtccttatctgc
cgcgaggaacctttggacaacagcagtgtcaaagccatttcccaaagccctgtgagtgaa
cagcagccatccaatctgcctgactgtgtccccctggaaatcaagatcactgacctgatc
tacacagtgctggatctggttcctgtgctgcaggtgaagcagctggtgcgtactctcggt
gtgatggatacagagatcgaacaagctgagatggatcacagatcctgccgggaggctcac
taccagatgctgcgggtgtgggctgagagagggtctcgtgcaggtggaggaggacgaggt
ggaatgctgcactggtcgttgatgcaggagttgtcagacatactgagaaagatgcacctg
ggaagggcggcggaggagctagagacaaagtatggcattcagtaa

KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111669911
Entry
111669911         CDS       T06058                                 

Definition
(RefSeq) tumor necrosis factor receptor superfamily member 1A-like isoform X1
  KO
K03158  tumor necrosis factor receptor superfamily member 1A
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal04010  MAPK signaling pathway
slal04060  Cytokine-cytokine receptor interaction
slal04150  mTOR signaling pathway
slal04210  Apoptosis
slal04217  Necroptosis
slal04920  Adipocytokine signaling pathway
slal05132  Salmonella infection
slal05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:slal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111669911
   04150 mTOR signaling pathway
    111669911
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111669911
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    111669911
   04217 Necroptosis
    111669911
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    111669911
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111669911
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    111669911
Cytokine receptors [BR:slal04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   111669911
CD molecules [BR:slal04090]
 Proteins
  111669911
SSDB
Motif
Pfam: TNFR_c6 Death stn_TNFRSF12A TMEM154 Orf78 EphA2_TM DUF2207 Insulin_TMD
Other DBs
NCBI-GeneID: 111669911
NCBI-ProteinID: XP_023282184
LinkDB
Position
Unknown
AA seq 392 aa
MTMEGAGHRGRWIKKAHYGTTLLLMCTLTLASLEPSEKKKCETGEYESENGICCNKCHRG
SKLIEECHAPGQRSNCTPCPDNQYMDNMNSATNCKSCRSCTKRNEFQFSPCKKYENTICR
CISGYYKYDIDGDTSECRKCKQCGPHEKEKQKCTLEENTVCECKEKYYKVKGKCEPCENC
TNECSHLCQNLHTKAPDKGNEFLINIIVGVVSVGFLLLVLVVLITYIVTKRCTQRNLQKP
PSQPSDVSPDSCEQVLICREEPLDNSSVKAISQSPVSEQQPSNLPDCVPLEIKITDLIYT
VLDLVPVLQVKQLVRTLGVMDTEIEQAEMDHRSCREAHYQMLRVWAERGSRAGGGGRGGM
LHWSLMQELSDILRKMHLGRAAEELETKYGIQ
NT seq 1179 nt   +upstreamnt  +downstreamnt
atgacaatggagggggctgggcacagaggaagatggattaaaaaggcccattatggcaca
acactccttctcatgtgcacgttaactttggcaagtttagagccttcagagaagaagaag
tgtgagaccggggaatatgaaagtgaaaatggaatttgttgcaacaaatgccatcgaggt
tctaagcttatagaagaatgtcatgctccgggtcagagaagtaactgcacgccctgtcct
gataaccaatacatggacaatatgaactctgccaccaactgcaaaagttgcagaagttgt
acaaaacgaaatgaatttcagttctcgccatgtaaaaaatatgaaaacactatttgtcgg
tgtatcagtggttattacaaatatgacattgatggagacacatccgagtgtcgcaaatgc
aaacaatgtggtcctcatgaaaaggaaaaacagaaatgcacactggaggaaaacactgtc
tgtgaatgtaaggagaaatactacaaagtcaagggcaagtgtgaaccctgcgagaattgt
accaatgagtgttcacatctctgtcaaaacctgcatacaaaagctcctgacaaaggaaat
gaatttctcataaacataattgttggagttgtatctgtgggttttctattgttggtgttg
gtggttcttatcacctacatagtcacaaaaaggtgcacccagaggaatttgcaaaaaccg
ccttcccaaccgtctgatgtttccccggactcttgcgagcaggtccttatctgccgcgag
gaacctttggacaacagcagtgtcaaagccatttcccaaagccctgtgagtgaacagcag
ccatccaatctgcctgactgtgtccccctggaaatcaagatcactgacctgatctacaca
gtgctggatctggttcctgtgctgcaggtgaagcagctggtgcgtactctcggtgtgatg
gatacagagatcgaacaagctgagatggatcacagatcctgccgggaggctcactaccag
atgctgcgggtgtgggctgagagagggtctcgtgcaggtggaggaggacgaggtggaatg
ctgcactggtcgttgatgcaggagttgtcagacatactgagaaagatgcacctgggaagg
gcggcggaggagctagagacaaagtatggcattcagtaa

DBGET integrated database retrieval system