KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111669291
Entry
111669291         CDS       T06058                                 

Gene name
ccnd1
Definition
(RefSeq) G1/S-specific cyclin-D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal04068  FoxO signaling pathway
slal04110  Cell cycle
slal04115  p53 signaling pathway
slal04218  Cellular senescence
slal04310  Wnt signaling pathway
slal04340  Hedgehog signaling pathway
slal04371  Apelin signaling pathway
slal04510  Focal adhesion
slal04530  Tight junction
Brite
KEGG Orthology (KO) [BR:slal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    111669291 (ccnd1)
   04340 Hedgehog signaling pathway
    111669291 (ccnd1)
   04371 Apelin signaling pathway
    111669291 (ccnd1)
   04068 FoxO signaling pathway
    111669291 (ccnd1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    111669291 (ccnd1)
   04115 p53 signaling pathway
    111669291 (ccnd1)
   04218 Cellular senescence
    111669291 (ccnd1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111669291 (ccnd1)
   04530 Tight junction
    111669291 (ccnd1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 111669291
NCBI-ProteinID: XP_023281318
LinkDB
Position
Unknown
AA seq 292 aa
MEDQLLCCEVDSIRRAYQDVNLLNDRVLHTMLKAEETYLPSPNYFKCVQKEIVPKMRKIV
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSVEATRKTRLQLLGATCMFLASKMKETVPLT
AEKLCIYTDNSVQPGELLQMELLVLNKLKWDLASVTPHDFIEHFLSKLKIYPSTKQILRK
HAQTFVALCATDVNFIASPPSMVAAGSVVAAVQGLYLKSQDASLSSQNLTNFLSQVIRSD
PDCLRSCQEQIESLLESSLRQAQQLSSSTETKRVDEDVDLSCTPTDVRDINI
NT seq 879 nt   +upstreamnt  +downstreamnt
atggaggaccagctgctgtgctgcgaggtggactccatcaggagagcctaccaggacgtc
aacctgctcaacgaccgggtcctccacaccatgctgaaggcagaggagacctacctgcct
tcgcccaactacttcaagtgtgttcagaaggaaattgtgcctaaaatgaggaaaatagtt
gctacctggatgttggaggtctgcgaggaacagaaatgtgaggaggaggtttttcccctg
gctatgaactatttggacagatttttatcagtggaggccaccaggaaaacacgactacag
ctgctgggagctacgtgcatgtttctagcatccaagatgaaggagactgtgcccttaacg
gcggagaaactctgcatctacacggacaactcggtccagcctggagaactcctgcaaatg
gagctgctggttctcaacaagctgaagtgggacctggcttcagtcacacctcacgacttc
atcgagcacttcctgtccaagctgaagatctacccgtccaccaagcagatcctcaggaag
catgcccagacatttgtggcgctctgtgctacagatgttaacttcatcgccagtcctccg
tccatggtggcggcaggcagtgtggttgcagctgttcaaggtctctacctgaagagtcaa
gacgcctccttatcctcccaaaacctcaccaacttcctgtcgcaggtcattcgcagcgac
ccggactgcttgcggtcatgtcaggagcagatcgagtctctgctggagtccagcctgcgg
caggctcagcagctcagcagcagcacagaaaccaaacgtgtggacgaggacgtggacctg
tcctgcacgccgacagacgtcagagacataaacatctga

DBGET integrated database retrieval system