KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111670101
Entry
111670101         CDS       T06058                                 

Gene name
npy
Definition
(RefSeq) pro-neuropeptide Y
  KO
K05232  neuropeptide Y
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal04080  Neuroactive ligand-receptor interaction
slal04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:slal00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    111670101 (npy)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    111670101 (npy)
SSDB
Motif
Pfam: Hormone_3
Other DBs
NCBI-GeneID: 111670101
NCBI-ProteinID: XP_023282438
LinkDB
Position
Unknown
AA seq 99 aa
MQPNMVSWLGTLGFLLWALLCLGALTEGYPVKPENPGEDAPAEELAKYYSALRHYINLIT
RQRYGKRSSPEILDTLVSELLLKESTDTLPQSRYDPSLW
NT seq 300 nt   +upstreamnt  +downstreamnt
atgcagcctaacatggtgagctggctggggactctggggttcctgctgtgggcgctgctc
tgcttgggcgccctgacggagggatacccggtgaaaccggagaaccccggggaggacgcc
ccggcggaggaactggccaaatactactcagcactgagacactacatcaacctcatcaca
agacagaggtatgggaagaggtccagccctgagattctggacacgctggtctcagagctg
ctgttgaaggaaagcacagacacacttccacagtcaagatatgacccgtcattgtggtga

DBGET integrated database retrieval system