KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111670446
Entry
111670446         CDS       T06058                                 

Gene name
rela
Definition
(RefSeq) transcription factor p65 isoform X1
  KO
K04735  transcription factor p65
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal04010  MAPK signaling pathway
slal04137  Mitophagy - animal
slal04210  Apoptosis
slal04218  Cellular senescence
slal04620  Toll-like receptor signaling pathway
slal04621  NOD-like receptor signaling pathway
slal04622  RIG-I-like receptor signaling pathway
slal04623  Cytosolic DNA-sensing pathway
slal04625  C-type lectin receptor signaling pathway
slal04920  Adipocytokine signaling pathway
slal05132  Salmonella infection
slal05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:slal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111670446 (rela)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    111670446 (rela)
  09143 Cell growth and death
   04210 Apoptosis
    111670446 (rela)
   04218 Cellular senescence
    111670446 (rela)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111670446 (rela)
   04621 NOD-like receptor signaling pathway
    111670446 (rela)
   04622 RIG-I-like receptor signaling pathway
    111670446 (rela)
   04623 Cytosolic DNA-sensing pathway
    111670446 (rela)
   04625 C-type lectin receptor signaling pathway
    111670446 (rela)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    111670446 (rela)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111670446 (rela)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    111670446 (rela)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:slal03000]
    111670446 (rela)
Transcription factors [BR:slal03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    111670446 (rela)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer
Other DBs
NCBI-GeneID: 111670446
NCBI-ProteinID: XP_023282926
LinkDB
Position
Unknown
AA seq 632 aa
MDGVYGWGMTPLNPVQTANPFIEIIEQPKQRGMRFRYKCEGRSAGSIPGEKSNDTTKTHP
AIKVHNYSGPLRVRISLVTKNAPHKPHPHELVGKDCKHGYYEADLQERRIHSFQNLGIQC
VKKKDVNEAITCRLQTNNNPFNIPEAKVWEEEFDLNSVRLCFQASITLPTGELFPLEPVV
SQPIYDNRAPNTAELKICRVNRNSGSCKGGDEIFLLCDKVQKEDIEVRFFQDSWEGKGTF
SQADVHRQVAIVFRTPPYRDTNLTEPIRVKMQLRRPSDREVSEPMDFQYLPSDPDEYRLS
EKRKRTGDMFQSLKLGPMLSSVSIPQDRRHISPARRTVTAKPPSMNPQAAAVVPPVASAV
KPQASYSFQPGQLFSIQPKVEASPSSSAVTTNQTWKIMESLNLGPQPKATPVANFTISQA
PSSSSSSSTTTSTANQDFSTVNLSDLHEFFPNISSAMAQEPTPSQGTTVSSQASSSFTLQ
APQFRVDDDDIPEFPIFPEAQAPGTLDSLNMDDFEDLLNPRLISEAGNGASMLAQASCQQ
AAPPSSSAAAQNTVSQNTSDPASQPGSTWMNYPNSIVNLLQNESMIIMASNNNNHQAPVL
DEFDELMSADEDRLISIFNSESQAGYVSGHQT
NT seq 1899 nt   +upstreamnt  +downstreamnt
atggacggtgtgtatggatggggcatgaccccactcaacccagtccaaacagcgaacccc
ttcatagagatcattgagcagccaaagcagagggggatgagatttaggtataagtgcgaa
ggacgctcagccggcagcattcctggagagaaaagcaatgacaccactaagactcaccca
gccatcaaggtgcacaattacagcggccccttgcgtgttcgcatttcactggtaacaaag
aacgcaccgcacaagcctcacccccatgaacttgttgggaaggactgcaaacatggctac
tacgaggccgacctgcaggagagaagaatacacagttttcagaacctgggcatacagtgt
gtgaagaagaaggatgtgaatgaggccatcacttgcaggctgcagacaaataacaacccc
ttcaacattcctgaggcgaaggtgtgggaggaagagtttgacctgaattcagtgcggctt
tgcttccaggcctccatcactctgcctacaggggagctgtttcctctggagcctgtggta
tcacagcccatttatgacaacagggccccaaacacagctgagctgaagatctgccgagtc
aaccgcaactctggaagctgcaagggaggggatgaaatctttctgctgtgtgacaaagtg
caaaaagaggacatcgaggtgcgtttcttccaggactcctgggagggaaagggcactttc
tcacaggccgatgtccacaggcaggtggccattgtgttccgtacaccgccctaccgcgac
actaatctcactgagcccattagagtcaagatgcagctccgccggccctctgaccgcgaa
gtcagtgagccaatggacttccagtacctgccctctgacccagatgaatacagactgagt
gagaagagaaaacgtacaggagacatgttccagagcctcaagctgggacccatgctgtct
agtgtgtccattccacaagatagacggcacataagcccagcaaggagaacagtcacagcc
aagcctccatcaatgaacccacaagctgcagctgtggtgccccctgttgccagtgcagtg
aaaccccaggcttcatactcatttcagccaggccagcttttctccatccagcccaaggta
gaggcctctccctccagctcagctgtgactacaaaccaaacatggaaaatcatggagagc
ctgaacctgggcccccagcccaaagccactccagtggccaacttcacaataagtcaggcg
ccatcttcctcctcttcctcctctacaaccacctccactgccaaccaggacttctccact
gtcaacctgtcagaccttcatgaatttttccccaacatttcctcagccatggcccaggag
cccacaccttctcaggggaccactgtctcctctcaggccagcagctccttcaccctccag
gcccctcagttccgggtggatgatgatgatatcccagaattccctatctttcctgaagcc
caggccccaggtaccctggacagcctaaacatggatgactttgaggaccttctgaacccc
cgcctcatcagcgaggctggaaatggcgcctcaatgttggcccaagcttcatgtcaacaa
gccgcccctcccagctcctccgctgctgcccagaacacagtatcccagaacacttctgac
cctgccagccaaccaggtagcacctggatgaattaccccaacagcattgtcaacttgctc
cagaacgagagcatgattatcatggcatccaacaacaacaaccaccaggcccctgtgctg
gatgagtttgatgagttgatgtctgctgacgaggatcgtcttatttccatttttaacagc
gaaagccaagctgggtatgtgtcaggacaccagacttaa

DBGET integrated database retrieval system