KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111670659Help
Entry
111670659         CDS       T06058                                 

Definition
(RefSeq) signal transducer and transcription activator 6-like
  KO
K11225  signal transducer and activator of transcription 6
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal04217  Necroptosis
Brite
KEGG Orthology (KO) [BR:slal00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    111670659
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:slal03000]
    111670659
Transcription factors [BR:slal03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    111670659
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: STAT_bind STAT_int STAT_alpha SH2
Motif
Other DBs
NCBI-GeneID: 111670659
NCBI-ProteinID: XP_023283238
LinkDB All DBs
Position
Unknown
AA seq 760 aa AA seqDB search
MAQWLHMSQLIQCLSDETVNNLYPPSAFPIEVRHFLAEWIESQRWDDFVLEKVEQESQSR
ALLDQIINMLQSIAQQNANVVDRMKLMQISRNMTMFQQQPLQFGVMVRDILRKERVLLGT
PTQIPNPPQYQQYPSTESSFPNMQDVDHLVLKVLEVQDIRQKMHQLQEELNWERQNYEGL
QGPIQPNGLDPAKSEIQKLQSHIQQLEYNVKAMATKRFQLLQECVDCLDQCQTRLVTRLK
AWRWEQHKATIGHPFDENLNPLQTWCEQLLGVNGKLRQELMLIVESIPELQERLGQLLQV
LIQSSLVVDKQPPQVIKTQSKFSTTVRYLLGEKVAPGKPVVLKAQIINELQARNLASVPG
DNVGELINNTAILEHNTASKSTCATFRNMSIKKIKRADRKGSESVTEEKFALLFSTEITI
TGCDTPYRIQTISLPVVVIVHGSQDNNALATIIWDCAFSEPDRVPFVVPERVPWRMMYST
LNSKFTSEVQTQHNLDHYNQHFLAQKIFDKPDFADDFSNMMVSWAQFNKEVLPGRPFTFW
QWFEGVMDLTKRHLKTYWSEGLIFGFIGKQHLHLILKDRPNGTFLLRFSDSEIGGITIAY
VSASENGGLKIQNIQPFTKRDLEIRSLGDRIRDINHITHLYPEFPKHEVFKKFYSEPQPS
PAGGYIPVSLRTKVGMEAGSATPPPPIMAPMAENPHSSVTFPVRQFQQPFSPQESIPQDI
METATNSDEFSSPSPVVFTELPAGNNMDLDLDSILQTLNN
NT seq 2283 nt NT seq  +upstreamnt  +downstreamnt
atggcccagtggctacacatgtcccagctgatccagtgcctgtctgatgagactgtcaac
aacctttatcccccgtccgccttccccatcgaagtcagacattttttagctgaatggatt
gagtcccaacgatgggacgactttgtgctggaaaaggtggagcaggagagccagtctcga
gctctgttggaccagatcatcaacatgctgcagtctattgctcagcagaatgccaacgtg
gtggacaggatgaagctgatgcagatcagcaggaacatgactatgtttcaacagcagcct
ctacagtttggagtgatggtcagggacatcctcaggaaggaaagggttcttcttggcacg
cccactcagatccccaaccctccacagtaccaacagtacccgagtacagagtcctcgttc
cccaacatgcaggatgtagaccacctggttctgaaagtgctggaggtccaggacatacga
caaaagatgcaccagctgcaggaagagctcaactgggagagacagaactatgagggttta
caagggccaatccagccgaacggactggatcccgcaaagtcagaaatccagaaactccag
agccacatccagcagctggagtacaatgttaaagccatggccacgaagcgtttccagctg
ctgcaggagtgtgtggactgtttggaccagtgtcagactcgactggtcaccaggctgaag
gcgtggaggtgggagcagcacaaggccaccatcgggcatccctttgacgaaaacctcaac
cccctgcagacctggtgtgagcagctgcttggggtgaacgggaagctgagacaggaattg
atgctaatagtggaatcaattccagagctccaggaaaggctggggcaacttctgcaggtt
ctgattcaaagctctcttgtggtggacaagcagccacctcaggtcattaaaactcagtca
aagttctccaccaccgtgcgatatctgctgggggagaaagtagctcccgggaagcctgtg
gtgctgaaggcacaaatcattaatgaattgcaggccaggaacctggccagtgtacccggt
gataatgtcggggaactgatcaacaacaccgccatcctagaacacaacacggccagcaag
agcacgtgtgccacctttaggaatatgtccatcaagaagatcaagcgagccgacagaaag
ggatcagagtctgtgacagaagagaaatttgctctcctgttctccacagagatcaccatc
acaggctgtgacactccgtacaggatacagacgatctcactgcccgtggtggtcattgtc
cacggaagtcaagacaacaacgctctggccaccatcatatgggactgtgctttttctgaa
ccagacagagtgccgttcgtggtgcccgagcgcgtgccctggaggatgatgtacagcact
ctcaacagtaaattcacctccgaggttcagacgcagcacaatctggaccactacaaccag
cacttcttggcccagaagatatttgacaagcctgactttgccgatgacttcagcaacatg
atggtttcctgggcccagtttaataaggaggttctcccgggtcgaccgttcacattctgg
cagtggttcgagggagtgatggatctgaccaagaggcacctgaaaacctactggagcgaa
gggctgatatttggtttcattgggaagcaacatctacacctgattctcaaagacaggccc
aacgggacattcttgcttcgcttcagtgactctgagattggaggcatcaccatcgcttat
gtgtctgcttctgagaatgggggcctgaaaatccagaatatccagcccttcaccaagagg
gatcttgagatccgtagccttggtgaccgcatccgtgacatcaatcacataacacacctg
tatcctgaatttcctaaacatgaagttttcaaaaaattctactcagagcctcaaccatca
cctgccggaggttacatccctgtgtcactgcgcactaaagtgggcatggaagctggatca
gccacacccccacctcccattatggcccctatggctgaaaaccctcacagttctgttacc
ttccctgtgcgtcagttccagcagcccttcagcccacaagagtccatccctcaagacatc
atggaaactgcaactaactctgatgagttcagctcaccctctcctgttgtcttcactgaa
cttcccgcaggtaacaatatggacctagatttggacagtattctccagactctgaataat
tag

DBGET integrated database retrieval system